займ с плохой кредитной историей онлайн

Statik Selektah – Express Yourself ’08


Ft. Termanology, Talib Kweli and Consequence

They managed to pull it off without completely disrespecting the original.  

Statik Selekath ft. Termanology, Talib Kweli & Consequence – Express Yourself 

AddThis Social Bookmark Button

800 Responses to “Statik Selektah – Express Yourself ’08”

  1. Rey Says:


  2. Rey Says:





  3. Phuque Says:

    # Phuque Says:
    August 31st, 2007 at 4:36 pm


    >>>Oh Yeah…Phuque I’ll piss in your mothers face…and rape your lil sister…Record it and post it on you tube…



    # hip hop cops Says:
    August 31st, 2007 at 12:17 pm

    hootie welcome back

    *runs through like crocodile dundee*

    here, have this, mate


  4. Runnin.It Says:

    who is this funny looking white dude

  5. eskay Says:

    smh @ me having this post in draft since this morning and forgetting to publish it.

    looks like somebody’s got a case of the Fridays…

  6. Belize Says:

    Somebody tell talib to invest in nasal spray

  7. 456 Says:




    E Aka Nore
    Tha Masta Cow
    What’s Beef?


    This songs good they don’t embarass themselves but nothing compares to the original

  10. Dem aka GOMW,P Says:


    ^ http://www.tinyurl.com/2h5sj7

  11. hoodtalk.org Says:

    Who the fuck is this Chubby White Guy? The White Young Jeezy?

  12. hoodtalk.org Says:

    Niggas is getting carried away with the Photoshops….

    Every second of the day you spend thinking about me….makes me smile…

  13. Belize Says:

    456 Says:

    August 31st, 2007 at 4:42 pm


    wow..and with dat..my E-day is over

    Peace Nah

  14. Phuque Says:





  15. hoodtalk.org Says:

    “ Niggas get reckless wit the calls
    Because I’m fucking they bitch, while they buying breakfast in the mall “ – Lloyd Banks

  16. Belize Says:

    green eyes Says:

    August 31st, 2007 at 4:39 pm
    # hoodtalk.org Says:
    August 31st, 2007 at 4:35 pm

    greenie invest that money for a lap top in plastic surgery…you need it honey…

    ^ word? because i was thisclose to using it to fly to upland and paying some whore to squat over your face so you could finally know what pussy smells like.

    *Ether..that shyt to make ur soul burn slow*

  17. green eyes Says:

    looks like somebody’s got a case of the Fridays…

    ^ lol. i had that on wednesday

  18. Dem aka GOMW,P Says:

    greenie invest that money for a lap top in plastic surgery…you need it honey…

    ^ word? because i was thisclose to using it to fly to upland and paying some whore to squat over your face so you could finally know what pussy smells like.

    ^^ can i send you my whore bills too, or is this program only for people who don’t know what cooch smells like?

  19. Rey Says:

    Aight ya’ll, I’m outtie spadouttie.

    I’ll catch ya’ll on the weekend and…oogling Nice Rack Girl……………………………………… and I’m back.. I’ll see ya’ll over the wknd or on the Night Shift.


  20. 456 Says:

    ^ word? because i was thisclose to using it to fly to upland and paying some whore to squat over your face so you could finally know what pussy smells like.

    ^*left arms starts to feel numb

    *clutches chest

    *falls from the table

  21. 456 Says:

    ^^ can i send you my whore bills too, or is this program only for people who don’t know what cooch smells like?

    *daps dem

    dis nigga been killin em all day. lmao

  22. hoodtalk.org Says:

    I get pussy thrown at me (no feline)

  23. hoodtalk.org Says:

    456 when you lived in africa….did you lived in a house made of mud and twigs? with flies stuck on children’s faces?

  24. nation Says:

    where the fuck is the ferret… i heard he’s loose again

    here hootie hootie hootie

  25. green eyes Says:

    ^ word? you a twan play catch with those little fake plastic pussy sex toys?
    “ewww. i dont want to touch it”

  26. Paperstacker Says:




    Hootie u mad?

  27. landLORD Says:

    … Lil Mo cant get a post, but this fat white boy can ? … wtf … who’s responsible for this operation ? …

  28. eskay Says:


    pussy > air & water

  29. landLORD Says:

    eskay Says:

    August 31st, 2007 at 5:06 pm

    pussy > air & water


    … finally got your first piece huh ? … congratulations …

  30. hoodtalk.org Says:

    green eyes Says:

    August 31st, 2007 at 5:03 pm
    ^ word? you a twan play catch with those little fake plastic pussy sex toys?
    “ewww. i dont want to touch it”

    ^Shut up bitch…you think im good lookin…

  31. landLORD Says:

    … whaddup tho Darius ? …

  32. eskay Says:

    >>Lil Mo cant get a post, but this fat white boy can ? … wtf … who’s responsible for this operation ? …

    Lil Mo who? that hood rat with the blue weave?

  33. Belize Says:

    anybody know how to hold a double edged razor in thier mouth? One edged in eazy, but double is pro nba nfl level

    any tips would be vital to survival in this crazy e-world where nigasoncomputers are like Ninjas

  34. 456 Says:

    # hoodtalk.org Says:
    August 31st, 2007 at 5:02 pm

    456 when you lived in africa….did you lived in a house made of mud and twigs? with flies stuck on children’s faces?

    ^huh? sorry i dont speak slave…

  35. hoodtalk.org Says:

    Landlord what it do bruh?

  36. Mark Twain Fame Says:

    statik selektah looks like a 2nd cousin I have that stole my Mike Tyson’s Punch Out! when I was like 9…that muhfucker.

  37. Dem aka GOMW,P Says:

    *daps 456*

    *daps landLORD*

    yo land, i got some female friends that wanna holla at you. they sent me this to entice you:


  38. 456 Says:

    Lil Mo who? that hood rat with the blue weave?


  39. Paperstacker Says:

    Lil Mo cant get a post, but this fat white boy can ? … wtf … who’s responsible for this operation ?


    How does Lil’ Mo fall into the hip Hop category?

  40. landLORD Says:

    ^ word? because i was thisclose to using it to fly to upland and paying some whore to squat over your face so you could finally know what pussy smells like.


    … did Green Eyes really type this ? …

  41. hoodtalk.org Says:

    Tyson is a strong negro…

  42. green eyes Says:

    ^Shut up bitch…you think im good lookin…

    ^ no, i like real men.

  43. nation Says:

    dropping that knowledge!!

  44. Paperstacker Says:

    lol, The beat for “Good Morning” is crack. It’s better than 50% of the beats on Curtis alone, and this is just an intro.

  45. green eyes Says:

    indeed landLORD.

  46. landLORD Says:

    Paperstacker Says:

    August 31st, 2007 at 5:11 pm
    Lil Mo cant get a post, but this fat white boy can ? … wtf … who’s responsible for this operation ?


    How does Lil’ Mo fall into the hip Hop category?


    … she’s hiphop … how does the word “cracker” fall into the hiphop xategory category ? …

  47. landLORD Says:

    edit: delete xategory ^^

  48. hoodtalk.org Says:

    Keep downloading Kanye West’s album…

    I don’t want no one buying that niggers album…

  49. crazy88SINCE88 Says:

    hoodtalk.org Says:

    August 31st, 2007 at 4:48 pm
    Niggas is getting carried away with the Photoshops….

    Every second of the day you spend thinking about me….makes me smile…

    LOL… Son’em HOOTS!


    Tyson is a strong negro…

  51. 456 Says:

    and i dont front/and /i dont walk backwards/and i dont practice/and i dont lack shit

  52. crazy88SINCE88 Says:


  53. 456 Says:

    Every second of the day you spend thinking about me….makes me smile…

    ^he does have a point

  54. landLORD Says:

    Dem aka GOMW,P Says:

    August 31st, 2007 at 5:10 pm
    *daps 456*

    *daps landLORD*

    yo land, i got some female friends that wanna holla at you. they sent me this to entice you:



    … smh … i knew it was bad news when i had to log in, and confirm birthdate to watch it … the one in the back in all white and the one in pink could still get it tho, on the strength … the slobs wearing black would die virgins …


    Mayweather to appear on Dancing With The Stars,
    and he’s fighiting Ricky Hatton Dec. 10 in Vegas

  56. nation Says:

    >> … the one in the back in all white and the one in pink could still get it tho, on the strength … the slobs wearing black would die virgins …

    i really don’t know what’s funnier

  57. green eyes Says:

    # 456 Says:
    August 31st, 2007 at 5:18 pm

    Every second of the day you spend thinking about me….makes me smile…

    ^he does have a point

    ^ he only smiles because he knows 98% of nah is male

  58. eskay Says:

    >>she’s hiphop … how does the word “cracker” fall into the hiphop xategory category ?

    there are no caucasians on this song

  59. Mark Twain Fame Says:

    The Boatlift > Curtis

  60. Dem aka GOMW,P Says:

    the one in the back in all white

    ^^ yeah i can’t even front on her. i’d saddle up and off into the sunset we’d go.

  61. Paperstacker Says:

    she’s hiphop … how does the word “cracker” fall into the hiphop xategory category ? …

    Come on Land, I mean seriously.

    LF: I finally listening to the Graduation shit. How can anyone front on the production on this album? The intro alone is better than 50% of shit thats out. Champion’s production is crazy too. I ain’t even listened to the lyrics in depth cause the beats alone can carry most of the songs. I mean niccas saying the production is kind of lackluster need to listen to the shit on some real speakers in the crib/whip or headphones or something, I mean folks jumping to conclusions playing a song on 2 watt computer speakers, talking bout the beat didn’t sound that good. smh,

  62. nation Says:

    >> there are know caucasians on this song

    knowne of them?


  63. 456 Says:

    ^ he only smiles because he knows 98% of nah is male

    ^this we know.

  64. nation Says:

    >> http://www.tinyurl.com/2fo8zb

    hoodtalk is the anti-poon

  65. landLORD Says:

    … why do all white boys in hiphop cut their hair into the fake caesar ?, like they are afraid they wouldnt be accepted with their more natural longer, mangy dog-type mane … they all look like Fat Joe wannabees …

  66. Mark Twain Fame Says:

    there are no caucasians on this song

    ^^statik selektah isnt caucasians…in that pic he looks like stale saltine to me.

  67. It'smeSNITCHES Says:

    Not U

  68. hoodtalk.org Says:

    Landlord hates White People

  69. 456 Says:

    knowne of them?

    ^ether biscuit

  70. Paperstacker Says:

    Production+Lyrics on Homecoming=Crack, damn.

  71. Mark Twain Fame Says:

    MTF likes White Castles.

  72. landLORD Says:

    Eskay said

    there are no caucasians on this song


    … i dont care about the song … i find the picture offensive …


    there are no caucasians on this song
    Termanology is 1/2 white

  74. It'smeSNITCHES Says:

    nation Says:

    August 31st, 2007 at 5:25 pm
    >> http://www.tinyurl.com/2fo8zb

    hoodtalk is the anti-poon

    LOL…..hell no….

  75. crazy88SINCE88 Says:

    ….i aint a fan of these niggas, but the Hook up is VERY 85′-86’…i remember my uncles rockin this shit back then… i gotta find those Kicks & Hat, ASAP. thats Oct.07 Fall shit. See: tinyurl.com/yrtr9h

  76. landLORD Says:

    hoodtalk.org Says:

    August 31st, 2007 at 5:26 pm
    Landlord hates White People


    … not all of them … but indeed, a vast amount would make the cut ….

  77. eskay Says:

    >>i dont care about the song … i find the picture offensive

    get over it or I’ll make next week Whiteboy Week

  78. hoodtalk.org Says:

    What is your fav. song on the GRADUATION

  79. landLORD Says:


    August 31st, 2007 at 5:28 pm
    there are no caucasians on this song
    Termanology is 1/2 white


    … exactly … and i aint too sure about the other half either … he sure looks like Drew Brees to me …

  80. nation Says:

    >> … why do all white boys in hiphop cut their hair into the fake caesar ?, like they are afraid they wouldnt be accepted with their more natural longer, mangy dog-type mane … they all look like Fat Joe wannabees …

    first of all… you mad… second of all, what white 16 year old peed in your beer and said it was apple juice… third of all…


  81. hoodtalk.org Says:

    Landlord you wouldn’t marry a White Girl that looks like Pamela Anderson or Jenna Jameson?

  82. It'smeSNITCHES Says:

    Where that pussy hole “Phuque face” is?

  83. landLORD Says:

    hoodtalk.org Says:

    August 31st, 2007 at 5:32 pm
    Landlord you wouldn’t marry a White Girl that looks like Pamela Anderson or Jenna Jameson?


    … id let one blow me …

  84. hoodtalk.org Says:

    I hate Wiggers….If it wasn’t for Eminem…these Wiggers would be running around in White Robes and Burning Crosses in the front lawn of Project Buildings…

  85. crazy88SINCE88 Says:

    hoodtalk.org Says:

    August 31st, 2007 at 5:32 pm
    Landlord you wouldn’t marry a White Girl that looks like Pamela Anderson or Jenna Jameson?

    dem bitches look like dudes, pick 2 more broads.

  86. hoodtalk.org Says:

    Kanye West’s album

    4.5 / 5


  87. nation Says:

    >> … not all of them … but indeed, a vast amount would make the cut ….

    man… that’s cause you think white people hate black people… white folk have bigger problems now… one of them being blaming the chinese for anything and everything because they’re better than them


    ^ Two-Times

  88. It'smeSNITCHES Says:

    LOL @ nation

  89. Phuque Says:

    # It’smeSNITCHES Says:
    August 31st, 2007 at 5:32 pm

    Where that pussy hole “Phuque face” is?


    *e-smacks snitches for throwing water balloons at a giant*

    You should be honored by my lateness…

  90. nation Says:

    >> get over it or I’ll make next week Whiteboy Week

    >> What is your fav. song on the GRADUATION

    >> I hate Wiggers….If it wasn’t for Eminem…

    you’re wack… you act like the Beastie Boys didn’t help Def Jam, the leading Hip Hop label, as much as LL Cool J or any other rapper did

  91. landLORD Says:

    Nation said

    first of all… you mad… second of all, what white 16 year old peed in your beer and said it was apple juice… third of all…


    … im not mad at all … its just that the past, present, and future has too much of their evilwork just fucking up everything for everyone … id be a blind fool to ignore or forget … but i still judge every person I encounter personally, on their own merits …

  92. green eyes Says:


    ^ *curtis’ career*

  93. nation Says:


    >> get over it or I’ll make next week Whiteboy Week


    >> What is your fav. song on the GRADUATION

    don’t change the subject http://www.tinyurl.com/2fo8zb

  94. Phuque Says:

    “Upside down is gangsta”


    *ghostrides the hearse*

  95. hoodtalk.org Says:

    Nation stfu nigga..before I go to montreal and stomp you little frail ass out….


  96. landLORD Says:

    Nation said

    you act like the Beastie Boys didn’t help Def Jam, the leading Hip Hop label, as much as LL Cool J or any other rapper did


    … bullshit Homes … help them do what ? … sell out ? … defjam always been on that crossover bullshit … (c) RunDMC & Aerosmith …

  97. Mark Twain Fame Says:

    MTF = YT

    dont e-elbow drop me LandLord.

  98. nation Says:

    >> … im not mad at all … its just that the past, present, and future has too much of their evilwork just fucking up everything for everyone … id be a blind fool to ignore or forget …

    fuck then, hate the europeans, hate the fucking british, hate the fucking dutch, hate the british again for breeding americans… don’t hate someone for the color of their melanin deprived skin cause then you’re no better than any white person you hate (for the same reason you hate them)

    the kind of person you hate is either dead or a part of a dying breed… there are way too many hippies in the world, hugging trees protesting for their to be any racist, fascist, bigot bastards left.

  99. It'smeSNITCHES Says:

    *slaps phuque*
    Yo Phuque face did u like the Graduation album?

  100. hoodtalk.org Says:

    Portland IS PUSSY




    SMFH..aint nothing hood about Montreal and Portland….

  101. Mark Twain Fame Says:

    but there is something e-thug about typing in all caps…


    >> … im not mad at all … its just that the past, present, and future has too much of their evilwork just fucking up everything for everyone … id be a blind fool to ignore or forget …

    fuck then, hate the europeans, hate the fucking british, hate the fucking dutch, hate the british again for breeding americans… don’t hate someone for the color of their melanin deprived skin cause then you’re no better than any white person you hate (for the same reason you hate them)

    the kind of person you hate is either dead or a part of a dying breed… there are way too many hippies in the world, hugging trees protesting for their to be any racist, fascist, bigot bastards left.
    Yeah, there’s no reason to hate someone for their skin color; but white privillage and racisim is still very prevelant

  103. eskay Says:

    Belize, that shit was uncalled for yo.

    Now if I go copy and paste War & Peace in the comments of your site i’d be wrong right?

  104. nation Says:

    >> … bullshit Homes … help them do what ? … sell out ? … defjam always been on that crossover bullshit … (c) RunDMC & Aerosmith …

    the only crossing over the Beastie Boys did was going from punk rock to hip hop… which is a good look

  105. Mark Twain Fame Says:

    j/k hood.

  106. hoodtalk.org Says:

    White Girls make up for it…

    Thats why White Girls like Brothas…

    and they suck and fuck….

  107. Phuque Says:


  108. Mark Twain Fame Says:

    hoodtalk.org Says:

    August 31st, 2007 at 5:46 pm
    White Girls make up for it…

    Thats why White Girls like Brothas…

    and they suck and fuck….

    ^^^…and buy you new Jordans.

  109. landLORD Says:

    nation said

    the kind of person you hate is either dead or a part of a dying breed… there are way too many hippies in the world, hugging trees protesting for their to be any racist, fascist, bigot bastards left.


    … and those are the kinds of crackers im cool with … but it my line of work, and where I live, unfortunately I have to continuously be confronted with the dying breed … and being Muslim is 4 strikes against you in the South …

  110. nation Says:

    >> Nation stfu nigga..before I go to montreal and stomp you little frail ass out….

    i’d like to see you leave Twan’s unfaithful ass alone in a gay ass city like Frisco for more than a few days… come back, dudes mouth’ll be pregnant, you’ll be broken in pieces… don’t overextended your reach

    there’s only so much you can do online… your barking up the wrong tree. Mac may visit Greenie offline, but there’s no place in my life for another dick-sucking drama queen like you doggie

  111. Mark Twain Fame Says:

    hood = Polow Da Don

  112. Phuque Says:

    … and those are the kinds of crackers im cool with



  113. landLORD Says:

    … i dont hate people because of the color of their skin … its much deeper than that … its more spiritual warfare than race warfare … it just so happens that my primary antagonists are of European descent …

  114. Mac Brown Says:

    Mac may visit Greenie offline, but there’s no place in my life for another dick-sucking drama queen like you doggie

    ^^LMAO……… you just had to bring that up!!

    ***goes back to lurking behind trees

  115. hoodtalk.org Says:

    Mark Twain Fame Says:

    August 31st, 2007 at 5:48 pm
    hood = Polow Da Don

    ^I’ve been working out lately…

    been trying to get big muscles like Polow Da Don has…

  116. nation Says:

    >> and they suck and fuck….

    other dudes… you a dirty head-oral-sexual, no bitch wants a part of you

  117. yeah me 2 Says:

    Mac did you hit that atleast?

  118. nation Says:

    >> … i dont hate people because of the color of their skin … its much deeper than that … its more spiritual warfare than race warfare … it just so happens that my primary antagonists are of European descent …

    spirit? http://www.youtube.com/watch?v=MwsWskgKe5E

  119. Mac Brown Says:

    @ LAND

    you in south caro right?

    Damn homey……..my condolensces.

    I had a homeboy who traveled there due to his job. Said its like going back to the 1600’s…. Dude swore he saw a runaway slave running down the street being chased by hillbillies

  120. nation Says:

    >> Mac did you hit that atleast?

    only thin he’s gonna hit is the ESC button

  121. Dem aka GOMW,P Says:


    ^ Becky “Buckwild” Johnston, Flavor of Love contestant who described herself as being “straight outta Upland”

    well, that explains it.

  122. Belize Says:

    eskay Says:

    August 31st, 2007 at 5:45 pm
    Belize, that shit was uncalled for yo.

    Now if I go copy and paste War & Peace in the comments of your site i’d be wrong right?

    Chill homie..its not like posted bullshyt..thats real world current affairs..and i was just tryin to see if anybody would be interested in anythiing other than white girls and Statik’s skin colour

    for the record, you can post Kenneth Waltz’s whole piece on my blog and as long as it wasn’t bullshyt it wouldn’t mess my day up…but my bad if it messed urz up

  123. nation Says:

    LMFAO… owned


  124. The-XFacta Says:

    *Daps in a 360 degree rotation*

    What’s good Nah Righters?

  125. landLORD Says:


    … speaking of she-devils … id bang your white homegirl Becky (Buckwild) …

  126. yeah me 2 Says:

    Wat is the ESC button?

  127. green eyes Says:

    # yeah me 2 Says:
    August 31st, 2007 at 5:52 pm

    Mac did you hit that atleast?

    ^^ mofo– who is you???

  128. Phuque Says:



    Hootie’s actual photo

  129. OnPoint Says:

    landLORD Says:

    August 31st, 2007 at 5:56 pm

    … speaking of she-devils … id bang your white homegirl Becky (Buckwild) …

    ^^^^Buckwild got BATS (big ass titties)

    Hows that for an entrance…whaddup nah?

  130. landLORD Says:

    green eyes Says:

    August 31st, 2007 at 5:57 pm
    # yeah me 2 Says:
    August 31st, 2007 at 5:52 pm

    Mac did you hit that atleast?

    ^^ mofo– who is you???


    *72 Virgins*

  131. green eyes Says:

    # landLORD Says:
    August 31st, 2007 at 5:49 pm

    … i dont hate people because of the color of their skin … its much deeper than that … its more spiritual warfare than race warfare … it just so happens that my primary antagonists are of European descent …

    ^ mine too.. tends to make family functions somewhat tense

  132. nation Says:

    >> mofo– who is you???

    You know ?? (c) Phuck

  133. Dem aka GOMW,P Says:

    … speaking of she-devils … id bang your white homegirl Becky (Buckwild) …

    ^ oooooooo… yo… she got New York sized sweater puppets now… i’d have them bouncin in my lap something vicious… hootie you need to stop trippin and hook that up for me.


    … i dont hate people because of the color of their skin … its much deeper than that … its more spiritual warfare than race warfare … it just so happens that my primary antagonists are of European descent …

    ^ mine too.. tends to make family functions somewhat tense

  135. nation Says:

    >> Hows that for an entrance…


    how’s that for an exit



  137. yeah me 2 Says:

    Dam babygirl no need 2 b rude….I was just asking ma

  138. Big Homie Says:

    New post in my blog. Couldnt think of anything today, but it was discussed today. Laters

  139. OnPoint Says:

    nation Says:

    August 31st, 2007 at 6:00 pm
    >> Hows that for an entrance…


    how’s that for an exit

    ^^^Yo fuck that!!!…u trying to make me hootie?!??! Ill bring my goons by Quebec ninj….Dont test me.

  140. landLORD Says:

    green Eyes said

    ^ mine too.. tends to make family functions somewhat tense


    … what is your ethnic composition ? …

  141. nation Says:

    >> Yo fuck that!!!…u trying to make me hootie?!??! Ill bring my goons by Quebec ninj….Dont test me.

    lmfao. you should holler at Sour D. & HHF… they usually come through. i’ll holler at Darth and we can all scrap it out in front of my igloo, the winner can have my all you can Eal coupon…

  142. OnPoint Says:

    Yeah thas right Nation….u shook. My e-gangsta is onpoint.

  143. nation Says:

    >> … what is your ethnic composition ? …

    uh oh… greenie, choose your words very carefully. nah jk, land… i forgot about the difference between where i live and the states…

  144. landLORD Says:

    Mac Brown Says:

    August 31st, 2007 at 5:53 pm
    @ LAND

    you in south caro right?

    Damn homey……..my condolensces.

    I had a homeboy who traveled there due to his job. Said its like going back to the 1600’s…. Dude swore he saw a runaway slave running down the street being chased by hillbillies


    … yep … the stereotypes are true …

  145. OnPoint Says:

    nation Says:

    August 31st, 2007 at 6:08 pm
    >> Yo fuck that!!!…u trying to make me hootie?!??! Ill bring my goons by Quebec ninj….Dont test me.

    lmfao. you should holler at Sour D. & HHF… they usually come through. i’ll holler at Darth and we can all scrap it out in front of my igloo, the winner can have my all you can Eal coupon…

    ^^^I dont know who Sour D is, but you a wild kid

  146. Phuque Says:

    Aight my ninjas….its been real, its been fun, but it ain’t been real fun.

    I’m on vacay next week…holla @ ya’ll whenevere the fuck I feel like it….have a good holiday weekend and don’t do drugs…

    …give them to me :)

  147. landLORD Says:

    Mark Twain Fame Says:

    August 31st, 2007 at 5:41 pm
    MTF = YT

    dont e-elbow drop me LandLord.


    … lmao … i just now got that … clever …

  148. Dem aka GOMW,P Says:

    i forgot about the difference between where i live and the states…

    ^ …like -20 to -40 degrees centigrade, chump…

  149. OnPoint Says:

    AIte, Im out like gout

  150. moneyray Says:

    curtis > graduation

  151. landLORD Says:

    eskay Says:

    August 31st, 2007 at 5:31 pm
    >>i dont care about the song … i find the picture offensive

    get over it or I’ll make next week Whiteboy Week


    … just make sure you start it with Pete Nice & Serch (3rd Bass)… and end it with El P and Aesop Rock … all them others whiteboys are insignificant …

  152. Two-Times Says:

    I Run Nahright….

    taxing all y’all fools…

  153. That Man Says:

    # landLORD Says:
    August 31st, 2007 at 5:30 pm

    hoodtalk.org Says:

    August 31st, 2007 at 5:26 pm
    Landlord hates White People


    … not all of them … but indeed, a vast amount would make the cut ….


    What about the ones that sign your checks?

  154. landLORD Says:

    Two-Times Says:

    August 31st, 2007 at 6:21 pm
    I Run Nahright….

    taxing all y’all fools…


    … Eskay ? …

  155. Dem aka GOMW,P Says:

    What about the ones that sign your checks?

    ^ shit. them especially.

  156. landLORD Says:

    That Man Says:

    August 31st, 2007 at 6:23 pm
    # landLORD Says:
    August 31st, 2007 at 5:30 pm

    hoodtalk.org Says:

    August 31st, 2007 at 5:26 pm
    Landlord hates White People


    … not all of them … but indeed, a vast amount would make the cut ….


    What about the ones that sign your checks?


    … I hate them the most … sheeeeit … you dont know the half of it kid …

  157. landLORD Says:

    … like im supposed to like these motherfuckers for underpaying me for what i already earned, whilst some other devils tax the hell out of it … GTFOH … you cant be serious …

  158. Two-Times Says:

    landLORD Says:

    … Eskay ? …


    Not taxing eskay ofcourse…

    Eskay is like the Jimmy Iovine of this shit… I’m like the 50… I run Nahright… and sometimes I wild out and be on that, “people think Eskay my boss…Fuck Eskay”…type shit…

    but nah, me & Eskay good… we stay gettin that money…

  159. landLORD Says:

    … while more rich devils take mad loot for bullshit Insurance policies … and im a liscensed Insurance Agent …

  160. Two-Times Says:

    Curtis “the album of the year” by 50 Cent

  161. landLORD Says:

    … 1 …

  162. The-XFacta Says:

    Soulja Boy
    U Mad?
    Ha Ha
    Help This Album Go Double Mercury

  163. nation Says:


  164. nation Says:

    damn we did joey dirty… we forgot his birthday

    someone said it was last month though… lol

  165. nation Says:

    damn… if ty forgot to buy him a gift it’s gonna be paaanic at the disco

  166. OnPoint Says:

    Phuque Says:

    August 31st, 2007 at 4:38 pm
    # Phuque Says:
    August 31st, 2007 at 4:36 pm


    >>>Oh Yeah…Phuque I’ll piss in your mothers face…and rape your lil sister…Record it and post it on you tube…



    # hip hop cops Says:
    August 31st, 2007 at 12:17 pm

    hootie welcome back

    *runs through like crocodile dundee*

    here, have this, mate


    ^^^^^OH SHIT….thats the most etherest ether I ever seen…and I dont want to see it ever again.

  167. OnPoint Says:

    ^^^I beat you to it kid

    Ok im gone for real


    Lupe “Dumb it down” is ridiculous. The cool might do crazy numbers.

    GRaduation is so fucking good…..Robot is a genius! If I wasnt a cheap mofucka I might cop 3, but Im definetly copping 1 of that

    Peace kids

  168. OnPoint Says:

    ^^^Im mean here

  169. Two-Times Says:

    Aight y’all… I”m out…

    Frank’s not around anymore….. I Run Nahright

  170. nation Says:

    fyi… there happens to be a shite load of Joe Budden songs in the comments section of my last post

    have a nice weekend… *everything i’m not made me everything i am*

  171. Furiou$tylez...I'm So Chicago Says:

    here, have this, mate


    my computer just no homoverloaded…

  172. crazy88SINCE88 Says:

    landLORD Says:

    August 31st, 2007 at 5:49 pm
    … i dont hate people because of the color of their skin … its much deeper than that … its more spiritual warfare than race warfare … it just so happens that my primary antagonists are of European descent …

    Fuckin Right!
    (88 puts on Iron Koofee, Grabs Choppa)


  173. crazy88SINCE88 Says:

    @ LandLORD…

    Check Out Ur Girl.

  174. crazy88SINCE88 Says:

    u niggas out’cha fuckin mind if this chick aint bad. tinyurl.com/32t4zm

  175. cOLD Says:

    Nahrizzle im on my 2nd cup of Remi, say a happy birthday for ya boy, (not the part time blogger) . Listening to face and loving my online niggas, no homo not necessary. marinate on that!

  176. cOLD Says:

    not being cocky, but I’m wondering the validity of some of yall cats, …we dont know each other on a personal level, and claiming hood on a blog aint the shit, I just saying i reconize the real ones. And on that note, I’m bout to sink down low in the whip, and follow the yellow lines to a better time.


  177. crazy88SINCE88 Says:

    cOLD Says:

    August 31st, 2007 at 8:40 pm
    Nahrizzle im on my 2nd cup of Remi, say a happy birthday for ya boy, (not the part time blogger) . Listening to face and loving my online niggas, no homo not necessary. marinate on that!

    *daps cold*
    happy bornday kid.

    *GOES back to lookin @ Rihannas ass.*

  178. cOLD Says:

    oh, and before I forget to mention, Nations blog is aggressive,…. Eskay watch out, there might be a movie of the week made about this. Established blogger takes out hit on competitionl.

  179. LL(not the rappa) Says:

    green eyes Says:

    August 31st, 2007 at 4:39 pm
    # hoodtalk.org Says:
    August 31st, 2007 at 4:35 pm

    greenie invest that money for a lap top in plastic surgery…you need it honey…

    ^ word? because i was thisclose to using it to fly to upland and paying some whore to squat over your face so you could finally know what pussy smells like.

    ^^^ETHER REPLAY #4567000099

  180. LL(not the rappa) Says:

    happy b-day cOLD

  181. LL(not the rappa) Says:


  182. crazy88SINCE88 Says:

    LOL @ LL

  183. cOLD Says:

    LL anytime you say tumbelweeds, you have to quote the father and put a (c) cOLD, I have you know I’ve been reppin Nah going on 3 years.

  184. LL(not the rappa) Says:

    what up crazy88 *looks around* *statik selektah crickets*

  185. cOLD Says:

    oh damn hootie was up in here, damn dude got the fifth element; look it up.

  186. crazy88SINCE88 Says:

    ..aint shit LL, up workin…

  187. LL(not the rappa) Says:

    cOLD Says:

    August 31st, 2007 at 8:58 pm
    LL anytime you say tumbelweeds, you have to quote the father and put a (c) cOLD, I have you know I’ve been reppin Nah going on 3 years.

    ^^^^lol..umm its your born day and dont wanna do this to you..but my booy EnglandRepresent been saying ‘tumbleweeds’..kinda stole it from him… proof? go back in time and lets see your nah posting records..lol

  188. LL(not the rappa) Says:

    if I win 330 mill,I’ll post on nahright and shout out eskay..true story..lol

  189. crazy88SINCE88 Says:

    LL(not the rappa) Says:

    August 31st, 2007 at 9:02 pm
    if I win 330 mill,I’ll post on nahright and shout out eskay..true story..lol

    (trys to remember LLs Skypager Number)
    “dang’It” (c: Rey)

  190. LL(not the rappa) Says:

    lol @ skypager

  191. LL(not the rappa) Says:

    crazy88SINCE88 Says:

    August 31st, 2007 at 8:30 pm
    u niggas out’cha fuckin mind if this chick aint bad. tinyurl.com/32t4zm

    ^^see Beyonce “Irreplacable”

  192. cOLD Says:

    ok LL, Eng Rep better keep it all the way official, and let Nah know where he got it from. Or eles.

    btw wifey curling her hair(no weave) and Im gonna paint the city red, not before stoppin in Yonkers and smacking Eskay and J-hood for the dumb shit.

  193. crazy88SINCE88 Says:

    LL(not the rappa) Says:

    August 31st, 2007 at 9:08 pm
    crazy88SINCE88 Says:

    August 31st, 2007 at 8:30 pm
    u niggas out’cha fuckin mind if this chick aint bad. tinyurl.com/32t4zm

    ^^see Beyonce “Irreplacable”

    See: Beyonce “Upgrade” (i.e. Ri-Ri)

  194. LL(not the rappa) Says:

    cOLD Says:

    August 31st, 2007 at 9:12 pm
    ok LL, Eng Rep better keep it all the way official, and let Nah know where he got it from. Or eles.

    btw wifey curling her hair(no weave) and Im gonna paint the city red, not before stoppin in Yonkers and smacking Eskay and J-hood for the dumb shit.

    ^^lol @ no weave..aight..when England posts we’ll see(no stevie)..have fun and let us know about it..

  195. cOLD Says:

    yo Crazy wha gwan, mi no know wha mek ah tru yardi man di ya pon fri.

  196. crazy88SINCE88 Says:

    cOLD Says:

    btw wifey curling her hair(no weave) and Im gonna paint the city red, not before stoppin in Yonkers and smacking Eskay and J-hood for the dumb shit.


  197. LL(not the rappa) Says:

    cOLD Says:

    August 31st, 2007 at 9:15 pm
    yo Crazy wha gwan, mi no know wha mek ah tru yardi man di ya pon fri.

    ^^^him have toooo much guiness annn red stripe

  198. crazy88SINCE88 Says:

    cOLD Says:

    August 31st, 2007 at 9:15 pm
    yo Crazy wha gwan, mi no know wha mek ah tru yardi man di ya pon fri.

    i aint doin shit, i gotta finish workin on this website…one of my side ventures, i’ll tell u cats once its done.

  199. LL(not the rappa) Says:

    lol….bashment for cOLD 2nitee

  200. cOLD Says:

    him have toooo much guiness annn red stripe

    ^den no muss, cho!, ifa no fi me burtday, meeda finish fi me Red Stripe lang time.

  201. crazy88SINCE88 Says:

    cOLD Says:

    August 31st, 2007 at 9:21 pm
    him have toooo much guiness annn red stripe

    ^den no muss, cho!, ifa no fi me burtday, meeda finish fi me Red Stripe lang time.

    we need that Offic.NahRight party. that shit would be OFF THEEE hook.

  202. cOLD Says:

    Sad thing is my bro offered my some puff puff, but I swore the shit off, …but the Remi talkin.

    *like fuck wifey, you the man*

  203. crazy88SINCE88 Says:

    cOLD Says:

    August 31st, 2007 at 9:30 pm
    Sad thing is my bro offered my some puff puff, but I swore the shit off, …but the Remi talkin.

    *like fuck wifey, you the man*

    wifey smell that spliff on u, ur ass is sleepin on the couch.

  204. cOLD Says:

    Aight Nah on some real ish. I love this Hip Hop shit, that being said; Fuck Billz

    ^LOL no relation, I just felt like blasting the mayor. .aight im gone one hunned Crazy.

  205. Furiou$tylez...I'm So Chicago Says:

    LL(not the rappa) Says:

    August 31st, 2007 at 9:02 pm
    if I win 330 mill,I’ll post on nahright and shout out eskay..true story..lol

    if i win this 300 mill, i aint touchin another computer in my life…

    unless im watchin porn and my cawk is in my other hand…

    [no hootie visiting fuckmyferrett.com]

  206. Furiou$tylez...I'm So Chicago Says:

    Statik Selektah = Bubba Sparxx 2007

  207. Furiou$tylez...I'm So Chicago Says:

    guess im the only ninja here on a friday night…

    fuck your personal lives…

  208. Foekist Says:

    Furiou$tylez…I’m So Chicago Says:

    August 31st, 2007 at 9:57 pm
    guess im the only ninja here on a friday night…


    Sheeeit, I’m sittin on the couch watchin Law and Order with a laptop in my lap while my girl is out at a concert.

    I lost.
    *tries to make self feel better*
    At least I chose to lose.

  209. Foekist Says:

    X Facta ain’t updated his site too much since last week, who go the connects with some good zshares of some new songs? Furious?

  210. Furiou$tylez...I'm So Chicago Says:

    Sheeeit, I’m sittin on the couch watchin Law and Order with a laptop in my lap while my girl is out at a concert.

    I lost.
    *tries to make self feel better*
    At least I chose to lose.

    my guys talkin about goin to the boogie negro club which means a nigga has to put on a shirt and some shoes and come out a dub at the door…

    but im not doin shit else…or i could just take my ass to sleep…

    Foekist Says:
    August 31st, 2007 at 10:04 pm

    X Facta ain’t updated his site too much since last week, who go the connects with some good zshares of some new songs? Furious?


  211. Foekist Says:

    Furious, you ain’t got no zshare goodness on your site that Eskay ain’t already got on nahright youngin.

  212. Furiou$tylez...I'm So Chicago Says:

    Foekist Says:
    August 31st, 2007 at 11:02 pm

    Furious, you ain’t got no zshare goodness on your site that Eskay ain’t already got on nahright youngin.

    ^^^i know, it was just a good chance to plug my site [nh]…

    and i had that Lupe when eskay was tucked in comfortably on Joe Buddens couch…check the time logs…

    I Run Bloggin…

  213. State of Grace Says:

    You definitely stepped your blog game up in the past few days Furiou$, you heard Graduation yet? I’m just finishing my first listen, and although I could do without Drunk and Hot Girls, I dig it. Album marks the first time I’ve heard T-Pain and not wanted to murder him in front of his family though

  214. Furiou$tylez...I'm So Chicago Says:

    State of Grace Says:

    August 31st, 2007 at 11:33 pm
    You definitely stepped your blog game up in the past few days Furiou$, you heard Graduation yet? I’m just finishing my first listen, and although I could do without Drunk and Hot Girls, I dig it. Album marks the first time I’ve heard T-Pain and not wanted to murder him in front of his family though

    yea, im diggin it, but its kinda hard for me to listen to some shit while sittin on the computer flippin thru websites…so i really wont be able to judge it until i put it on cd and ride around in the car listening to it, which ill probably do tomorrow…

    and yes, kanye did bring the best out of t pain or his singing machine rather…

    You definitely stepped your blog game up in the past few days Furiou$

    thank you sir…

  215. G7 Says:

    *statik crickets*

  216. cMac Says:


    he loooossttt

  217. k-rob aka guy brewer Says:

    In order to promote his new album, Curtis, 50 Cent will perform five separate live shows in New York City the week of his album release. While details are still sketchy, 50 will reportedly be performing in one location in each of the city’s boroughs during the weekend of September 15. Fans in the New York area that are interested in attending the 50 Cent 5 Borough Tour can listen to radio station Hot 97, where tickets will be given away throughout Labor Day Weekend. Stay


  218. nation Says:

    ^ okay gay rob… that’s another one of 50’s desperate attempts… jayz’s hangar tour > begging dudes in ny to like you

    >> Furious, you ain’t got no zshare goodness on your site that Eskay ain’t already got on nahright youngin.

    but we already knew that

    *points gun in the air*
    *lets of several shots*
    *holsters gun*

  219. nation Says:

    and thug we not familiar… cross me ima pop and kill ya


  220. green eyes Says:

    superbad > your life

  221. yeah me 2 Says:

    Wat up greenie

  222. nation Says:

    >> superbad > your life


  223. Belize Says:

    sit on weezy if u hating


    peace nah..a nigga drunk and …yeah

  224. Foekist Says:

    Get a life Greenie…. sheezus khrist. 3:39am?

  225. cMac Says:

    so umm….good morning

  226. HHF Says:

    ^^^click it for my mesmerizing musings

  227. It'smesnitches Says:


    I found Cam….

  228. tyrone biggums Says:

    @ foe – i just answered your question at my spot……smh @ me already taking days off for the shit…..i got too much shit to do this weekend…..

  229. G7 Says:

    seen Nore’s new album in a store yesterday. I had no clue it was out.

  230. Furiou$tylez...I'm So Chicago Says:

    nation Says:

    September 1st, 2007 at 2:55 am
    ^ okay gay rob… that’s another one of 50’s desperate attempts… jayz’s hangar tour > begging dudes in ny to like you

    i was just gonna say thats reminisent of the hanger tour…

    we see how well that worked for Jay…

  231. Furiou$tylez...I'm So Chicago Says:

    nation Says:
    September 1st, 2007 at 2:55 am

    >> Furious, you ain’t got no zshare goodness on your site that Eskay ain’t already got on nahright youngin.

    but we already knew that

    *points gun in the air*
    *lets of several shots*
    *holsters gun*

    *slaps nation*

    *takes gun out of his holster*

    *pistol whips his two front teeth out*

    *nation returns his gun to his holster and cries*

  232. HHF Says:

    ANy of yall watching ozone awards on MTV jamz……must hoodified award show ever.

  233. Furiou$tylez...I'm So Chicago Says:

    ^^^thats the worst shit ever. that shit is worse then last years, and i didnt think anything could get worse then that bullshit…

  234. Furiou$tylez...I'm So Chicago Says:

    greenie = drunk and hot girl…

  235. nation Says:

    >> *nation returns his gun to his holster and cries*

    only crying i’m going to be doing is a tatooed tear when you become Furiou$oul

  236. cocca88CRAZY88SINCE88 Says:

    It’smesnitches Says:

    September 1st, 2007 at 10:31 am

    I found Cam….

    …talk about waisted talent….that nigga could have been the 2nd come’n of A.I.

  237. HHF Says:

    On Ozone awards, Weezy says he just changed his name to hiphop

    I hope he runs with that, the controversy will go on forever

  238. green eyes Says:

    right back atcha foe

  239. Furiou$tylez...I'm So Chicago Says:

    nation Says:

    September 1st, 2007 at 1:41 pm
    >> *nation returns his gun to his holster and cries*

    only crying i’m going to be doing is a tatooed tear when you become Furiou$oul

    youre to soft to get a tattoo…

    green eyes Says:
    September 1st, 2007 at 2:09 pm

    right back atcha foe

    wow, foe is the only one u saw address you?

    i should piss in your fuckin cheerios…

  240. green eyes Says:

    what up Mr. $tylez. you know i love your high maintenance ass

  241. miltee Says:

    wow this 50 cent sucks,
    where’s the homo biggums? I’ve finally heard the clean retail which sounds worse than the massacre imo…

  242. 456 Says:

    my passport on pivot

  243. 456 Says:

    i’m all about about my franklins lincolns and reagans/
    whenever they make them/
    i shall hate them…oops i mean have them/

  244. nation Says:

    >> youre to soft to get a tattoo…

    your moms told you i waxed my nuts? damn, i knew she had a big mouth but gat damn

  245. HHF Says:

    ^^^ click for new post about:

    smh at Biggie’s myspace page having YOung Joc as the main picture and “Coffee shop” as the 1st song.

    Am I making too much of this?

  246. 456 Says:

    Am I making too much of this?

    ^yes its a fuckin myspace page

  247. nation Says:

    my bad that sounded mad gay

  248. nation Says:

    >> Am I making too much of this?

    funny you mention that… i was amazed at how fast Biggie got “replaced” by Shyne and that was that

  249. Foekist Says:

    green eyes Says:
    September 1st, 2007 at 2:09 pm

    right back atcha foe



  250. Foekist Says:

    tyrone biggums Says:

    September 1st, 2007 at 11:12 am
    @ foe – i just answered your question at my spot……


    no homo ty?

  251. HHF Says:

    456 Says:

    September 1st, 2007 at 2:43 pm
    Am I making too much of this?

    ^yes its a fuckin myspace page

    ^^^well it made for a good blog post

    though I dont know whether I should take advice from someone quoting corny Lil wayne rhymes….I meant that very respectfully

  252. HHF Says:


    myspace is very very important for any musician.

  253. Foekist Says:

    anybody got some zshares of new goodness?

  254. HHF Says:

    Check out that Blu and Exile on Nation’s page

    You gotta go buy the album tho. Im getting that album as soon a sI can.

  255. nation Says:

    >> anybody got some zshares of new goodness?

    you’re kidding right

  256. $***M-ROC***$ Says:

    ….and yet somehow, I’M the one who gets told that i’m “pulling the race card”?

    smh @ all y’all.

  257. nation Says:




    amongst others… depending on your taste

  258. HHF Says:

    $***M-ROC***$ Says:

    September 1st, 2007 at 2:53 pm
    ….and yet somehow, I’M the one who gets told that i’m “pulling the race card”?

    smh @ all y’all.

    ^^^I dont get it

    but you a fool for that link to your name..lol

  259. nation Says:

    >> anybody got some zshares of new goodness?

    *smacks self*


  260. 456 Says:

    though I dont know whether I should take advice from someone quoting corny Lil wayne rhymes….I meant that very respectfully

    ^sounds like it.

    lil wayne > will.i.am

  261. HHF Says:

    aite Im about to go get drunk…..college football tailgating with the cronies


  262. 456 Says:

    # $***M-ROC***$ Says:
    September 1st, 2007 at 2:53 pm

    ….and yet somehow, I’M the one who gets told that i’m “pulling the race card”?

    smh @ all y’all.

    ^u mad?

  263. HHF Says:

    456 Says:

    September 1st, 2007 at 2:58 pm
    though I dont know whether I should take advice from someone quoting corny Lil wayne rhymes….I meant that very respectfully

    ^sounds like it.

    lil wayne > will.i.am

    ^^maybe sometimes, but doesnt change the fact that your favorite Lil Wayne line from that song was corny when I first heard it, and corny now

  264. hoodtalk.org Says:


  265. 456 Says:

    ^^maybe sometimes, but doesnt change the fact that your favorite Lil Wayne line from that song was corny when I first heard it, and corny now

    ^you makin alot of assumptions. and i see the shit i talkin about is a little too high frequency for you to understand…its cool k.i.m. your night of drunken revelry awaits

  266. landLORD Says:

    “… i dont lack shit …” (c) Wayne …

    … irrelevant of its corniness, the cleverness of the line lays in how he said it … rhythmically, Wayne is at or near the top with his delivery … that said, the “Barry Bonds” verse aint one of his better recent verses … Kanye’s verse was too much for Wayne to follow … Weezy aint there yet …

  267. Foekist Says:

    nation Says:

    September 1st, 2007 at 2:53 pm
    >> anybody got some zshares of new goodness?

    you’re kidding right


    naw muthafucka, do I ever kid?

  268. landLORD Says:

    … @Nation …

    …appreciate the Blu and Exile links … had never heard of them … good music …

  269. Foekist Says:

    hoodtalk.org Says:

    September 1st, 2007 at 3:01 pm


    thanks homotalk

  270. 456 Says:

    landLORD Says:
    September 1st, 2007 at 3:12 pm

    “… i dont lack shit …” (c) Wayne …

    … irrelevant of its corniness, the cleverness of the line lays in how he said it … rhythmically, Wayne is at or near the top with his delivery … that said, the “Barry Bonds” verse aint one of his better recent verses … Kanye’s verse was too much for Wayne to follow … Weezy aint there yet …

    ^co-sign. that and i dont practice/and i dont lack shit end to that verse saved it from being just mediocre cause kanye murdered that verse…but his line about the reagans is ill if you stop to think about it…

  271. Foekist Says:

    nation Says:

    September 1st, 2007 at 2:56 pm
    >> anybody got some zshares of new goodness?

    *smacks self*



    Jay Electronica? The fuck is that

  272. 456 Says:

    Jay Electronica? The fuck is that

    ^the new backpack messiah

  273. HHF Says:

    Ill have some fun for I leave

    Yeah Im definetly a Wayne fan with the delivery and his flow

    But if you trying to type a memorable line, normally its for content, not for delivery


    are you sure you meant to use the phrase “too high frequency?”….do you know what that means

  274. HHF Says:

    Foekist Says:

    September 1st, 2007 at 3:20 pm
    nation Says:

    September 1st, 2007 at 2:56 pm
    >> anybody got some zshares of new goodness?

    *smacks self*



    Jay Electronica? The fuck is that

    ^^^Listen to that shit….its crack

  275. landLORD Says:

    … Jay Electronica is a cross between MFDOOM and Sean Price and Killah Priest …

  276. HHF Says:

    and to expand…Weezy says some clever shit every now and then, but that verse on Barry Bonds was soo weak, that no lines should be quoted from it

  277. HHF Says:

    landLORD Says:

    September 1st, 2007 at 3:26 pm
    … Jay Electronica is a cross between MFDOOM and Sean Price and Killah Priest …

    ^^^I agree

    I was trying to figure out who to add in with MF Doom….I would have said MF Doom and Wu Tang

  278. landLORD Says:

    … when it comes to posting good, new, rare hiphop, Nation is that dude …

  279. FuckUPayMe618 Says:


    Irv Gotti interview on Wendy Williams

  280. HHF Says:


    Im just fucking around with you…..its not that serious (c) Rey

  281. landLORD Says:

    … Darius, why you posting porn on the Sabbath ? … you ol’ heathen ass nicka …

  282. Foekist Says:

    That Jay Electronica shit ain’t that bad at all.

  283. 456 Says:

    are you sure you meant to use the phrase “too high frequency?”….do you know what that means

    ^lol…oh you comin out your mouth? nigga you postin will.i.am singles on your blog and you talkin about corny? foh. and yeah high frequency..cause you not on my level. clown…

  284. landLORD Says:

    HHF Says:

    September 1st, 2007 at 3:27 pm
    and to expand…Weezy says some clever shit every now and then, but that verse on Barry Bonds was soo weak, that no lines should be quoted from it


    … and that beat is so ill and sinister, im suprised he didnt do more with it …

  285. KingML Says:



    Why would I give $15 to a guy who brags about Louie Vitton bags?

    Anyone that’s richer than me, is not getting a god damned thing.

  286. Foekist Says:

    ^lol…oh you comin out your mouth? nigga you postin will.i.am singles on your blog and you talkin about corny? foh. and yeah high frequency..cause you not on my level. clown…



  287. HHF Says:

    456 Says:

    September 1st, 2007 at 3:33 pm
    are you sure you meant to use the phrase “too high frequency?”….do you know what that means

    ^lol…oh you comin out your mouth? nigga you postin will.i.am singles on your blog and you talkin about corny? foh. and yeah high frequency..cause you not on my level. clown…

    ^^^ok teacher, what is the definition of high frequency?

  288. landLORD Says:

    Foekist Says:

    September 1st, 2007 at 3:32 pm
    That Jay Electronica shit ain’t that bad at all.


    … word … im burnin them shits now …

  289. nation Says:

    >> … Kanye’s verse was too much for Wayne to follow … Weezy aint there yet …

    yeah but they weren’t in the studio together… the problem is, they both had the chorus, so why didn’t wayne do what he had to do… unless wayne did his verse and the chorus, which i doubt

  290. Foekist Says:

    Anyone that’s richer than me, is not getting a god damned thing.


    You must mean that any one that BRAGS about being richer than you. Cuz if that’s the case that means you have NEVER bought a cd or watched/went to the movies.

  291. HHF Says:

    landLORD Says:

    September 1st, 2007 at 3:34 pm
    HHF Says:

    September 1st, 2007 at 3:27 pm
    and to expand…Weezy says some clever shit every now and then, but that verse on Barry Bonds was soo weak, that no lines should be quoted from it


    … and that beat is so ill and sinister, im suprised he didnt do more with it …

    ^^^I have looped that beat so many times…that ish is crazy. Weezy must have had an off day

  292. FuckUPayMe618 Says:

    That Jay Electronica shit ain’t that bad at all.

    ^^Co-sign been listening to it for a couple days now

  293. Foekist Says:

    OK… It’s time for me to find something to do with my saturday… I’m still sick that I can’t smoke I gotta just drink more now I guess.

  294. landLORD Says:

    Foekist Says:

    September 1st, 2007 at 3:37 pm
    Anyone that’s richer than me, is not getting a god damned thing.


    You must mean that any one that BRAGS about being richer than you. Cuz if that’s the case that means you have NEVER bought a cd or watched/went to the movies.


    … or watched sports … or went to McDonalds … or went on vacation … rich people stay getting our/your money … thats why they’re rich …

  295. HHF Says:


    U win man…..thanks for visiting my blog too.

  296. HHF Says:

    ^^^click for Will-I-Am singles.

  297. HHF Says:

    peace out

  298. landLORD Says:

    … why would he release the worst song on the lp as the single ? (Cant Tell Me Nothing) … who is responsible? …

  299. Foekist Says:

    HHF Says:

    September 1st, 2007 at 3:41 pm
    ^^^click for Will-I-Am singles.


    Wow. You must really be hoodtalk… he’s the first cat I’ve ever seen on here to get clowned for something and come right back and do the same thing again.

  300. Foekist Says:

    landLORD Says:

    September 1st, 2007 at 3:42 pm
    … why would he release the worst song on the lp as the single ? (Cant Tell Me Nothing) … who is responsible? …


    Maybe you say it’s the worst because we’re all tired of it by now…? I would think that with all the remixes that he would at least change the beat up a little bit.

  301. 456 Says:

    ^^^ok teacher, what is the definition of high frequency?

    ^the universe is made of vibration. the slower the vibration the lower the frequency. coarse material like rocks and dirt vibrate slower. things such as light and sound vibrate at a higher frequency

    the higher the frequency the less likely low vibration maufuckas like you will be able to perceive it…which is how we got here in the first place.

  302. nation Says:

    >> … Jay Electronica is a cross between MFDOOM and Sean Price and Killah Priest …

    so much more though… some Nas, some Immortal Tech (with skills though), Phonte, some Pharrell-like BS… hell rell (jk)

    >> …appreciate the Blu and Exile links … had never heard of them … good music …

    lemme send you the album then

    >> but that verse on Barry Bonds was soo weak, that no lines should be quoted from it

    that’s what i said at first, but it’s full of gems after a few listens. kanye still murked it though.

    but remember that you should never outshine your boss, at least not the first time. let kanye rhyme better than you so that he can let you get on more tracks, without being scared, and then you can drop a crazy verse like on Can’t Tell Me Nothing… sorta

  303. Foekist Says:

    Wow we just lost to fuckin Appalachian St….

  304. nation Says:

    >> are you sure you meant to use the phrase “too high frequency?”….do you know what that means

    yo… 456 is a god, god

  305. 456 Says:

    barry bonds is the best track on graduation. that beat is one of, if not the illest of the year

  306. Foekist Says:

    456 Says:

    September 1st, 2007 at 3:46 pm
    ^^^ok teacher, what is the definition of high frequency?

    ^the universe is made of vibration. the slower the vibration the lower the frequency. coarse material like rocks and dirt vibrate slower. things such as light and sound vibrate at a higher frequency

    the higher the frequency the less likely low vibration maufuckas like you will be able to perceive it…which is how we got here in the first place.


    …which is directly related to the law of vibration…

    …which is the reason why we can’t see ultra violet rays or hear radio signals, because they vibrate at frequencies that are higher than what human senses can see/feel/hear, or w/e

  307. Foekist Says:

    edit^^ law of attraction

  308. nation Says:

    >> … I’m still sick that I can’t smoke I gotta just drink more now I guess.

    negative… not a good idea man

    >> … why would he release the worst song on the lp as the single ? (Cant Tell Me Nothing) … who is responsible? …

    that’s just how Kanye was feeling man… it’s an ill song and an ill concept, you just mad your kids look up to dudes brilliant tin can mind

  309. HHF Says:

    456 Says:

    September 1st, 2007 at 3:46 pm
    ^^^ok teacher, what is the definition of high frequency?

    ^the universe is made of vibration. the slower the vibration the lower the frequency. coarse material like rocks and dirt vibrate slower. things such as light and sound vibrate at a higher frequency

    the higher the frequency the less likely low vibration maufuckas like you will be able to perceive it…which is how we got here in the first place.

    ^^^thats just reaching…..you trying too hard to be smart.

    Ill say this…if you knew me in person, you wouldnt be trying to teach me science.

  310. Foekist Says:

    nation Says:

    September 1st, 2007 at 3:51 pm
    >> … I’m still sick that I can’t smoke I gotta just drink more now I guess.

    negative… not a good idea man


    you don’t drink huh

  311. HHF Says:

    Foekist Says:

    September 1st, 2007 at 3:46 pm
    Wow we just lost to fuckin Appalachian St….

    ^^Foekist, u at U of Michigan?

    I was just talking to a friend about that game……damn I cant fucking leave wtf

  312. 456 Says:

    ll say this…if you knew me in person, you wouldnt be trying to teach me science.

    ^yeah and if you knew me you wouldnt be tryina question my intelligence or my hiphop credentials. so i guess we even

  313. Foekist Says:

    ^^^thats just reaching…..you trying too hard to be smart.

    Ill say this…if you knew me in person, you wouldnt be trying to teach me science



    Actually he’s telling the truth.

  314. HHF Says:

    Foekist Says:

    September 1st, 2007 at 3:54 pm
    ^^^thats just reaching…..you trying too hard to be smart.

    Ill say this…if you knew me in person, you wouldnt be trying to teach me science



    Actually he’s telling the truth.

    ^^^Yeah but the way he used it was reaching

  315. Foekist Says:

    ^^Foekist, u at U of Michigan?

    I was just talking to a friend about that game……damn I cant fucking leave wtf


    Nah kid, i’ll be 28 this monf. I’m a U of M/Notre Dame fan.

  316. 456 Says:

    @ foe

    why cant you smoke?

  317. nation Says:

    >> you don’t drink huh

    no i do, but this hangover has me wanting to stop.

  318. Foekist Says:

    456 Says:

    September 1st, 2007 at 3:56 pm
    @ foe

    why cant you smoke?


    New gig I just started does random hair tessez

  319. Foekist Says:

    nation Says:

    September 1st, 2007 at 3:58 pm
    >> you don’t drink huh

    no i do, but this hangover has me wanting to stop.


    sheeeit you better start taking those Chaser pills. I’d buy stock in them muhfuckas if I could

  320. 456 Says:

    New gig I just started does random hair tessez

    ^you are now in the matrix. my condolences (c) land

  321. nation Says:

    Foe is gonna stop smoking, HHF is trying to school 456, eskay is being mentioned in the same article as Jeff Chang…

    we need a board

  322. HHF Says:

    actually 456 is schooling me….im learning

  323. HHF Says:

    actually 456 all jokes aside man….i hope its all good


  324. 456 Says:


    its all non-homo love

  325. THE-XFACTA Says:

    Yo who can loan me $1,000? I got you back on Wednesday

  326. Foekist Says:

    THE-XFACTA Says:

    September 1st, 2007 at 4:32 pm
    Yo who can loan me $1,000? I got you back on Wednesday


    I gotchu, but I charge interest. That’s not just cuz I don’t know you, even me and my potnaz pay each other back courtesy interest for lookin out.

  327. Mac Brown Says:


    Cam’ron will come out with an LP by Feb 08′

    Will take it back to the S.D.E days

    Lyrically will almost be on par with nas.

    ***Mac puts the crack pipe down

    later folks

  328. cMac Says:

    by the way… hootie lost

  329. landLORD Says:

    Nation said

    >>> that’s just how Kanye was feeling man… it’s an ill song and an ill concept, you just mad your kids look up to dudes brilliant tin can mind


    … i have no problem with the concept, i just hate the beat and that annoying “oh-oh-ohohoh” …

  330. landLORD Says:

    THE-XFACTA Says:

    September 1st, 2007 at 4:32 pm
    Yo who can loan me $1,000? I got you back on Wednesday


    … AYYYOOOO !!! …

  331. Foekist Says:

    Man new post please

    *sips vodka*

    I’m tired of lookin at this got damn cracka urrtime a nigga refresh the page

  332. Foekist Says:

    right now, Sept 1st, 2007 at 4:44pm…

    concreteloop > nahright

  333. 456 Says:

    *cracker-ass cracker crickets

  334. Foekist Says:


    since when is skippin the new crippin?

  335. It'smesnitches Says:

    Listening to Graduation for the 1st time

  336. Foekist Says:

    It’smesnitches Says:

    September 1st, 2007 at 5:16 pm
    Listening to Graduation for the 1st time


    from where

  337. It'smesnitches Says:

    Hootie had the link up yesterday…..I think eskay took it down by now tho

  338. It'smesnitches Says:

    Drunk And Hot Girls (Ft. Mos Def) ——my fav song so far……lol…..

  339. THE-XFACTA Says:


    Foekist Says:

    September 1st, 2007 at 5:21 pm
    It’smesnitches Says:

    September 1st, 2007 at 5:16 pm
    Listening to Graduation for the 1st time


    from where


    I got a couple songs posted on my site homie

  340. 456 Says:


  341. Mr.Londoner Says:

    “If you don’t cop ‘Graduation’ on September 11th you should prah’lee just go kill yourself. Go huff a gallon of paint, stick a hooker’s bedazzled stiletto in your eye socket and put you head in your momma’s oven. Kill yourself because you are killing Hip-Hop.”

    dallas penn

  342. 456 Says:

    @ drunk and hot girls

  343. It'smesnitches Says:

    His album is a little different for me…..its good……better then other albums thats been coming out lately…….worth buying……wish it had more songs tho……best song to me is “Big Brother”…….I didn’t listen to Curtis yet to tell who’s better…..

  344. plug industries Says:

    that kanye cd is timeless on so many different levels

  345. It'smesnitches Says:

    Graduation is

  346. It'smesnitches Says:

    Graduation is Worth buying

  347. plug industries Says:

    I aint got my hands on that curtis yet. anybody got it?


  348. THE-XFACTA Says:

    Graduation is ok but I actually like Curtis better (nh)

  349. 456 Says:

    listenin to curtis now. its a nice comparison graduation vs. curtis.

  350. THE-XFACTA Says:

    Hit me up Plug for that Curtis….


  351. plug industries Says:

    xfacta says

    I thought that was going to be the case until I listened to Kayne’s album this past week. Looks like Kayne did well on the production side, but his lyrics are very very dull and basic. I was a huge fan of his last two albums, but it looks like ‘Graduation’ is going to be a letdown. Ya may wanna get that ‘Curtis’ or possibly that Soulja Boy debut
    thats too much. I’ll give you the curtis opinion, but soulja boy? tahats to much.

    *inhales dutch*

  352. 456 Says:

    had a dream i was rich/woke up broke

    curtis takin it back

  353. THE-XFACTA Says:


    LOL.. It was a joke!

  354. 456 Says:

    plug, curtis shit is rockin right now

  355. 456 Says:

    i’m in like five songs deep and already i can say that 50’s shit bangs harder than kanye.
    but bang is not everything

  356. plug industries Says:

    soulja boy?!?!?!?!?


  357. plug industries Says:

    but bang is not everything
    *walks away from 456*

    *reaches under desk*

    *presses silent alarm*

  358. plug industries Says:

    Hit me up Plug for that Curtis….
    where at? n/h

  359. crazy88since88 Says:

    Others, however, are unconvinced and see a decline in a once vibrant art form. Eskay, author of Nah Right, a popular hip-hop blog, said: “I think there are a variety of factors and it would be crazy to say the internet hasn’t had an effect. But mostly there has been a decline in the quality of albums being put out.

    “Nowadays we see a lot of what have come to be known as ‘ringtone rappers’ who are essentially one-hit wonders. And everybody is an A&R nowadays. Everybody wants to know what the [sales figures] are for the week and everybody has an artist they’re pushing and a MySpace page. It’s awful.”

    SHOUTOUT ESKAY…..u dat nigga kid.

  360. plug industries Says:

    plug, curtis shit is rockin right now
    *presses alarm repeatedly nervously*

  361. 456 Says:

    but bang is not everything
    *walks away from 456*

    *reaches under desk*

    *presses silent alarm*

    ^dont get it. you sayin bang IS everything or are you sayin “bang is not everything'” is somehow homo?

  362. THE-XFACTA Says:


    plug industries Says:

    September 1st, 2007 at 6:10 pm
    Hit me up Plug for that Curtis….
    where at? n/h



  363. plug industries Says:

    456, somebody else from nahright is in the original homefront. cant remmber who though. gonj erased my memory

  364. plug industries Says:

    ^dont get it. you sayin bang IS everything or are you sayin “bang is not everything’” is somehow homo?
    …I dont know…pay me no mind…Im blowed…

  365. nation Says:

    yo… sickest shit just happened

  366. plug industries Says:

    yo… sickest shit just happened
    *pulls up chair in a non homo way*

    what be dun the happened

  367. plug industries Says:

    dam, I almost missed that comment, x. good lookin whoady nh

  368. plug industries Says:

    This no homo thing has spiraled out of control up here/ you know you dont need to say it but the massive population of frooty pebbles up here makes you have to say it.

  369. 456 Says:

    word @ plug. shit aint even funny no more. makes me nostalgic for 2006

  370. plug industries Says:

    ahight. I’m headed out to enjoy the rest of this beautiful, God given, 76 degree day. 5 stacks.

  371. crazy88since88 Says:

    456 Says:

    September 1st, 2007 at 6:50 pm
    word @ plug. shit aint even funny no more. makes me nostalgic for 2006

    AWWWWWWWWWWWW, Poor PLUG & 456: tinyurl.com/22yqfw

  372. plug industries Says:

    *adds nostalgic to mental database using usb port*

    *drives off playin “big brother”*

  373. Paperstacker Says:

    i’m in like five songs deep and already i can say that 50’s shit bangs harder than kanye.
    but bang is not everything


    Yeah, I was just listening to Curtis in the whip, the songs do bang. Beatwise its crazy in that way. Most of the beats have that thumping bass and are on some street shit. The Akon joint is fire too, he does a good job with the chorus. I have to say Curtis is a sold album. It’s not garbage by any means.

    But still, overall, Graduation shits on it by far. Graduation is on some soul, innovative shit, the beats on there are nice. But you can say both these albums are in their own lane. Curtis got alot of songs people will be hearing in the club and playing in their whips. Graduation not so much, its more of a personal listening experience, thats how good it is.

    Graduation>Curtis but I say everyone go cop both. Or download both, whatever.

  374. plug industries Says:

    *floats pass crazy 88 narrowly missing toes*

  375. crazy88since88 Says:

    plug industries Says:

    September 1st, 2007 at 6:59 pm
    *floats pass crazy 88 narrowly missing toes*

    (dave chappelle Black Gallagher VOICE)

    ….S’OmeBodys On ACID!….

  376. 456 Says:

    yeah co sign. but i’m startin to think curtis is gonna outsell kanye. kanye on some stevie wonder shit. he owe his entire rhyme persona to jigga tho. he took the blueprint and ran wit it.

  377. 456 Says:

    lol@ crzy8s

  378. Paperstacker Says:

    456 are you listening to the clean version or the retail of Curtis? I have the clean version, but I had heard retail had leaked earlier today or something.

  379. 456 Says:

    yeah i got the clean.

  380. nation Says:

    wow… i was walking around downtown bumping Eardrum just to prepare my mental self for tonight… not only is it a solid album but i met the dj to tonight’s show through a weird series of events… let’s get it poppin

  381. nation Says:

    >> let’s get it poppin

    gayest sequence of words, ever

  382. KonishiwaBitches Says:

    new post please, lets get it poppin….n/h

  383. Furiou$tylez...I'm So Chicago Says:

    i put that Kanye in the car today…


    thats all i have to say…

  384. green eyes Says:

    im still trying to resist the urge to listen to kanye. i dont know if i can tho if you mofos stay talking about it

  385. It'smesnitches Says:

    So who’s album is better? 50 or ye?

  386. k-rob aka guy brewer Says:

    graduation is good but damn 50 really came through, yall asked for it and he brought it, he gave us the commercial for single, the album is all southside baby

  387. k-rob aka guy brewer Says:

    damn i really need that dirty curtis!!!!!!
    cant wait to by this shit so i can really hear the beats

  388. k-rob aka guy brewer Says:

    # It’smesnitches Says:
    September 1st, 2007 at 8:06 pm

    So who’s album is better? 50 or ye?
    you should know by now, only because the haters cant hate on the obvious,i know niggas is mad that 50 came with the heat.
    like i been saying kanye is for special set of ppl and curtis is for the street, yes is said 50 made an album thats majority street.kanye is cool with that weird shit but cmon, i cant listen to that album more than twice an thats was me giving it a second chance

  389. It'smesnitches Says:

    Listening to the clean Curtis album now……like the 1st song so far

  390. k-rob aka guy brewer Says:

    “had a dream i was rich and i woke up broke” curtissss!!!!!!!!!!!!!!!!!!!!
    187 mtf

  391. k-rob aka guy brewer Says:

    # It’smesnitches Says:
    September 1st, 2007 at 8:33 pm

    Listening to the clean Curtis album now……like the 1st song so far
    come and go anf 187 are street classics, the flow is ferrari fa real

  392. k-rob aka guy brewer Says:

    fully loaded clip is a banger too, just not a single.that shit hits hard especially mix in with the rest of the tracks.
    niggas sleep on 50 cent street lyrics

  393. hoodtalk.org Says:

    Buy 50 Cents album…Don’t download it…

    Download Kanye West’s album…Don’t buy it…

  394. hoodtalk.org Says:

    50 Cent’s album is surprisingly good…

    This shit is damn near a classic

  395. Jeter22 Says:

    I’mmm Grimmy I’m Greaeeezy, I make uh 187 look easssyy!!!

    “nigga fuck that I lay my murda game down!!”

  396. Jeter22 Says:

    It’smesnitches Says:

    September 1st, 2007 at 8:33 pm
    Listening to the clean Curtis album now……like the 1st song so far

    So how far along are you? And what you think?

  397. Jeter22 Says:

    Did anybody use the link I posted for that curtis?

  398. hoodtalk.org Says:

    Curtis > The Graduation

  399. k-rob aka guy brewer Says:

    congratulations two time!!!!!!!!!!
    am gonna buy the album but i could not resist the download, the anticipation was too much. a feel much better now that i finally heard it. did yall notice how “fully loaded clip” sound better mix with the entire product and “touch the sky is a straight up banger!!!!!!!!!!!!!!!!
    hiphop is really alive now, thanks 50 and kanye too, but curtis alot better

  400. FuckUPayMe618 Says:

    How do you convert from rar into mp3?

  401. It'smesnitches Says:

    Jeter22 Says:

    September 1st, 2007 at 8:54 pm
    It’smesnitches Says:

    September 1st, 2007 at 8:33 pm
    Listening to the clean Curtis album now……like the 1st song so far

    So how far along are you? And what you think?

    Well right now I’m at the end….its at “187” the song everyone keeps talking about……but the album is good……50 came through with that street shit cats like (n/h)…….my fav. songs are “I still kill”, “Man down”, “Come and Go”, “My gun go off” and “All of me”…….with saying that I would say 50 album is better than Kanye’s……I like 2 songs on Graduation but 50 killed his album…..

  402. k-rob aka guy brewer Says:

    kanye need another song so he decide to dickride his boss? damn shame i can beleive he pulled a game/dre move with that big brother shit.i thought dame is who put him on, oh well

  403. k-rob aka guy brewer Says:

    this nigga is soo smart or his team is smart for putting all the commercial song together at the end nice!!!!!!!
    i aint when niggas mix up the flow of an album.keep the street togother and the club same.

  404. Jeter22 Says:

    FuckUPayMe618 Says:

    September 1st, 2007 at 9:04 pm
    How do you convert from rar into mp3?

    Open it with Itunes that should work or if you don’t already have it download winrar….

  405. It'smesnitches Says:

    That nigga said “y’all niggas know Boo Boo get busy”……lol…..

  406. Jeter22 Says:

    It’smesnitches Says:

    September 1st, 2007 at 9:06 pm
    Jeter22 Says:

    September 1st, 2007 at 8:54 pm
    It’smesnitches Says:

    September 1st, 2007 at 8:33 pm
    Listening to the clean Curtis album now……like the 1st song so far

    So how far along are you? And what you think?

    Well right now I’m at the end….its at “187″ the song everyone keeps talking about……but the album is good……50 came through with that street shit cats like (n/h)…….my fav. songs are “I still kill”, “Man down”, “Come and Go”, “My gun go off” and “All of me”…….with saying that I would say 50 album is better than Kanye’s……I like 2 songs on Graduation but 50 killed his album…..

    Did you use the link I posted or some other shit?

  407. k-rob aka guy brewer Says:

    where the fuck is that bitch ass rey?lol
    even a hater like him gotta give it up,
    2x where you at nigga beak out the don p nigga!!!!!
    the last track is soo appropriate number 17

  408. FuckUPayMe618 Says:

    Open it with Itunes that should work or if you don’t already have it download winrar

    ^^^right on

  409. Jeter22 Says:

    k-rob aka guy brewer Says:

    September 1st, 2007 at 9:13 pm
    where the fuck is that bitch ass rey?lol
    even a hater like him gotta give it up,
    2x where you at nigga beak out the don p nigga!!!!!
    the last track is soo appropriate number 17

    Whats track 17 again? Yea 2X needs to be here today!!!


  410. It'smesnitches Says:

    Did you use the link I posted or some other shit?

    I got it from X

  411. It'smesnitches Says:

    That fucking “I get money” is still FIRE to me……that fucking beat is sick

  412. Jeter22 Says:

    Ok cool….

  413. Foekist Says:

    Did you use the link I posted or some other shit?


    C’mon yall.. share the links my bruvah…. share the welf

  414. FuckUPayMe618 Says:

    share bee.com/a25c4690

    C’mon yall.. share the links my bruvah…. share the welf

    ^^^Sum 1 posted that one i just used it

  415. Jeter22 Says:

    Did it work?

  416. hoodtalk.org Says:

    12 Touch The Sky – 50 Cent ft. Tony Yayo

    is my fav. song

  417. Foekist Says:

    Jeter22 Says:

    September 1st, 2007 at 9:38 pm
    Did it work?


    jeyahhhh(c)Mc eiht

  418. Jeter22 Says:

    FuckUPayMe618 Says:

    September 1st, 2007 at 9:34 pm
    share bee.com/a25c4690

    C’mon yall.. share the links my bruvah…. share the welf

    ^^^Sum 1 posted that one i just used it
    So what you think of the album?

  419. FuckUPayMe618 Says:

    So what you think of the album?

    ^^ I aint listen yet. I think kanyes is gonna be better based off the last project tho

  420. Foekist Says:

    I’m hoping this shit finishes burning before the goons pick me up, I won’t have to pay for nothing all night having this cd in the whip.

  421. Foekist Says:

    I’m excited, gotta big tiddy beach meetin me out 2nite I met at rock the bells wednesday, life is good. We bout to get drunk!

  422. Jeter22 Says:

    hoodtalk.org Says:

    September 1st, 2007 at 9:40 pm
    12 Touch The Sky – 50 Cent ft. Tony Yayo

    is my fav. song

    The whole shit just roles well it all fits!!! He really went all in on Come & Go!!


  423. It'smesnitches Says:

    That nigga 2x probably fucking a chick listening to Curtis right now….lol….

  424. Jeter22 Says:

    Foekist Says:

    September 1st, 2007 at 9:44 pm
    I’m hoping this shit finishes burning before the goons pick me up, I won’t have to pay for nothing all night having this cd in the whip.

    Shit you might just want parking lot pimp and bang that shit and get all the hoes as the walkin in the spots!! cuzz that aint gone be in the club

  425. Jeter22 Says:

    It’smesnitches Says:

    September 1st, 2007 at 9:49 pm
    That nigga 2x probably fucking a chick listening to Curtis right now….lol….

    Sounds about right! lol

  426. Jeter22 Says:


    With the release of his third album, Curtis, around the corner, 50 Cent plans to kick-off the new album with five performances in New York City the week of the album’s release. According to XXL, the rapper will perform in one location in each of the city’s five boroughs during the weekend of September 15. Fans in the New York area that are interested in attending the 50 Cent 5 Borough Tour can listen to New York’s Hot 97, where tickets will be given away throughout Labor Day Weekend. …

  427. cMac Says:

    Does anybody know when Hootie’s funeral is?

  428. Foekist Says:

    Shit you might just want parking lot pimp and bang that shit and get all the hoes as the walkin in the spots!! cuzz that aint gone be in the club


    It’s only so much parking lot pimping you can do to the clean version. Especially a fiddy cd.

    Ain’t no way you can be cool knockin some shit like that… mufuckas gon’ be like “where yall cop that cd from, Wal Mart?”

  429. Foekist Says:

    Jeter22 Says:

    September 1st, 2007 at 10:09 pm

    With the release of his third album, Curtis, around the corner, 50 Cent plans to kick-off the new album with five performances in New York City the week of the album’s release. According to XXL, the rapper will perform in one location in each of the city’s five boroughs during the weekend of September 15. Fans in the New York area that are interested in attending the 50 Cent 5 Borough Tour can listen to New York’s Hot 97, where tickets will be given away throughout Labor Day Weekend. …


    Catch a late pass stankin azz (c) Mef

    Oh and for what it’s worth, when I used to live in Kalamazoo, my homeboy stayed 4 doors down from Derek Jeter, your mentor. And I used to try to get on his sister, Sharlee, in elementary to no avail, wayyyy before he was a sport star.

    Yeah I’m drunk, so what… But that’s the troof

  430. Foekist Says:

    Man fidduck 50 Cent, who got the Kanye jumpoff? nhjic

  431. Jeter22 Says:

    Did she look like much???

    What you think of the cd?

  432. Rey Says:

    There may yet be a chance to reinvent a musical form which came from the projects of New York to dominate the world in just 20 years. As for the imminent rap battle, it seems clear which side fans of hip-hop are on. “Do you even have to ask?” says Eskay. “Kanye all day, baby!”


    You tell ’em Simon!

  433. Foekist Says:

    Jeter22 Says:

    September 1st, 2007 at 10:45 pm
    Did she look like much???

    What you think of the cd?


    Sharlee was decent, in hindsight about a 6 or 7, I haven’t seen her in over 10 years. The cd was cool, I’m waiting till I hop in the truck till I listen to the rest I heard the first 3 tracks. Too much was bleeped out for my liking.

  434. FuckUPayMe618 Says:

    Listened to that Curtis album. I only liked 5 cuts on there. Listening to that Ye right now. Good Morning shits on a couple of tracks on that 50

  435. FuckUPayMe618 Says:

    Listened to that Curtis album. I only liked 5 cuts on there. Listening to that Ye right now. Good Morning shits on a couple of tracks on that 50 every single released from Curtis

  436. $***M-ROC***$ Says:

    that 50 was gaaaaaaarbage. “ya blind baby, ya blind to the fact of who you are”!

    sure, it was a bunch of new 50 tracks. that i cannot argue with. the only bad thing about that is that it sounds like the same, generic 50 album we’ve heard TWO TIMES before (no tony yayo). “i’m from the street, i get money, i get hoes, i got guns, blah blah..” yeah whatever, homie…you done made the same damn album three damn times. the shine has been off the turd for a while now, got anything new? didn’t think so. kanye won.

  437. Jeter22 Says:

    Finally, the haters arrive!!!

    They want a Blueprint or Graduation from 50 silly kids….

  438. $***M-ROC***$ Says:

    i never expected a blueprint from 50. at all.

    kanye won.

  439. cMac Says:

    yo yo

  440. cMac Says:

    # FuckUPayMe618 Says:
    September 2nd, 2007 at 12:00 am

    Listened to that Curtis album. I only liked 5 cuts on there. Listening to that Ye right now. Good Morning shits on every single released from Curtis


  441. Rey Says:

    In case anyone is on here this late, I have a new post over at my house.


  442. Furiou$tylez...I'm So Chicago Says:

    i hate everybody and everything that is worth hating…

  443. nation Says:

    blacksmith is the movement

    jean grae is the wifey

  444. Furiou$tylez...I'm So Chicago Says:

    i am starting to hate myself for hating you so much…

  445. nation Says:

    Jeter22 Says:
    September 1st, 2007 at 9:58 pm

    It’smesnitches Says:

    September 1st, 2007 at 9:49 pm
    That nigga 2x probably fucking a chick listening to Curtis right now….lol….

    Sounds about right! lol


    highly doubt that… unless his hand has a hole in it. he ain’t fucking no one else but his mind listening to that album

  446. Rey Says:

    Furiou$tylez…I’m So Chicago Says:

    September 2nd, 2007 at 2:17 am
    i am starting to hate myself for hating you so much


    No shots fired, but that sounds Emo as fuck.

  447. louiefuse Says:

    dam!… riaa shut down premos podcast! dam… dam… dam!

  448. D. Billz Says:

    jean grae is the wifey

    ^ e-z (c) murda mook (r.i.p. mook’s career)

  449. nation Says:

    >> dam!… riaa shut down premos podcast! dam… dam… dam!

    what the fuckkk

    >> e-z (c) murda mook (r.i.p. mook’s career)

    damn, i haven’t seen you in days… the grae-dar went off? she was spitting heavy tonight… my mans said better than Talib

  450. 456 Says:

    what up nation, where you see jean perform?

  451. nation Says:

    >> what up nation, where you see jean perform?

    Talib was in town tonight… he really held it down. Jean came on staged and pretty much put Talib’s screaming-into-the-mic mentality to shame. Jean really, really killed it. i have a new found respect for Kweli too… that guy loves what he does

  452. nation Says:

    what’s good with you… what continent you on? more importantly, where’s your mind travelling to tonight

  453. nation Says:

    >> “Do you even have to ask?” says Eskay. “Kanye all day, baby!”

    having a sense of humor, i’d say Austin Powers or Phil Hellmuth… knowing Curtis fans, they’d say you’ve had one to many interviews with the Louis Vuitton don

  454. It'smesnitches Says:

    I got 2 girls I can hit but I don’t wanna cheat on my girl…..why it always happen when u ain’t single……

  455. 456 Says:

    chillin in accra. reading zen and the art of motorcycle maintenance. listening to graduation and curtis and doing track by track analysis.

  456. nation Says:

    >> chillin in accra.

    damn… no wonder you talk foul to dudes… no way they’re going to come see you. what does accra look like? do you have any pictures that are more truthful than the official website or at least what the media depicts of Ghana?

    >> listening to graduation and curtis and doing track by track analysis.

    if you’re reading zen then you should know that Graduation = Curtis. those two are business partners, they cancel themselves out on some ying yang shit

  457. nation Says:

    new Jay-Z single


    >> chillin in accra.

    you said you got some land over there right… so i’m guessing that’s not in the city because i can google image that shit

  458. 456 Says:

    nah i got land in zambia. i just moved to ghana like a month ago. but i’ll be in brooklyn in oct. anybody want to speak directly, lol

  459. nation Says:

    wha da bloodclot: http://www.youtube.com/watch?v=MpzyqxsNjWU (Two-Times)

    >> nah i got land in zambia. i just moved to ghana like a month ago. but i’ll be in brooklyn in oct. anybody want to speak directly, lol


  460. plug industries Says:

    yo, somebody spott me a hunnet so I can go to the after hours spot. Its mad hoes up there and they all “hot and ready” just like them lil ceasers pizzas

  461. G7 Says:

    >>the only bad thing about that is that it sounds like the same, generic 50 album we’ve heard TWO TIMES before (no tony yayo). “i’m from the street, i get money, i get hoes, i got guns, blah blah..” yeah whatever, homie…you done made the same damn album three damn times.

    haven’t listened to Curtis yet, but this is exactly what I’m expecting. New tracks from 50, but same old shit.

  462. Frank White Says:

    i got 2 big guns that’ll give u second hand smoke

  463. yeah me 2 Says:

    Eskay Got A Fuckin Shaggadalic…..GROOOVVVEEEYYYYY BABBBBYYY

  464. miltee Says:

    Since kanye leaked first, 50 cent has an advantage for sales already… … he better not lose

  465. THE-XFACTA Says:

    Violence is the key!

  466. Game Over Says:

    kweli is always talking about people have to do more than vote to help the community, but i never hear about anything he’s doing in brooklyn. is there a talib kweli charter school somewhere in BK nobody told me about? LOL. i know son and mos bought the bookstore, but that was in 2002 or some shit. I read about 50 donating $150,000 to a community center in Queens. Mos got that movie money and Kweli has that tour money. Where are the checks?

  467. Game Over Says:

    smh @ landlord for not realizing that run dmc was NEVER signed to def jam.

  468. Game Over Says:

    my bad…i misspoke…50 donated the 150k for the renovation of Baisley Park by the Baisley Park Houses in Jamaica Queens.

    What’s Kweli done for Flatbush lately? LOL.

  469. THE-XFACTA Says:

    @Game Over,

    I don’t think Mos Def or Talib log onto Nahright, so write a letter to your Senator!! Why don’t motherphuquers get off they’re ass in BK instead of hoping some rapper gives them shit??? Why are people always looking for a hand out?? SMH @ Niggas Still Expecting a Mule and Some Acres
    “You Better Get Up Get Out & Get Something”

  470. cMac Says:


  471. cMac Says:


  472. THE-XFACTA Says:


  473. It'smesnitches Says:

    That “Can’t tell me nothing” is a straight classic…..I can’t get tired of it….

  474. cMac Says:

    # THE-XFACTA Says:
    September 2nd, 2007 at 11:28 am


    apple and oranges homie…
    but for the record:

  475. Foekist Says:

    can somebody please get me a link to the kanye leak?

  476. landLORD Says:

    *currently listening to Curtis*

    … i put this CD in with every intention to clown it and hate it …

    … however , im shocked by how consistently good it is from beginning to end … safe to say , this may be his best effort in years … if not ever … smh …

  477. landLORD Says:

    … ruby red grapfruit > orange …

  478. D. Billz Says:

    landLORD Says:

    September 2nd, 2007 at 12:55 pm
    *currently listening to Curtis*

    … i put this CD in with every intention to clown it and hate it …

    … however , im shocked by how consistently good it is from beginning to end … safe to say , this may be his best effort in years … if not ever … smh …

    ^How much they payin’ you?

  479. tyrone biggums Says:

    Foekist Says:
    September 2nd, 2007 at 12:53 pm
    can somebody please get me a link to the kanye leak?

    ….whats your email ?…..

  480. Foekist Says:

    tyrone biggums Says:

    September 2nd, 2007 at 12:58 pm
    Foekist Says:
    September 2nd, 2007 at 12:53 pm
    can somebody please get me a link to the kanye leak?

    ….whats your email ?…..



  481. Foekist Says:

    D. Billz Says:

    September 2nd, 2007 at 12:57 pm
    landLORD Says:

    September 2nd, 2007 at 12:55 pm
    *currently listening to Curtis*

    … i put this CD in with every intention to clown it and hate it …

    … however , im shocked by how consistently good it is from beginning to end … safe to say , this may be his best effort in years … if not ever … smh …

    ^How much they payin’ you?


    lol D Billz widdup!

  482. tyrone biggums Says:

    landLORD Says:
    September 2nd, 2007 at 12:55 pm
    *currently listening to Curtis*

    … i put this CD in with every intention to clown it and hate it …

    … however , im shocked by how consistently good it is from beginning to end … safe to say , this may be his best effort in years … if not ever … smh …

    ….i d/l’d it yesterday an started to listen…..i was shocked when i was putting them into my itunes…cause when playing just the first 3-5 seconds i was impressed with the beats like…wow curtis might have brought some dope music…then i started to listen more…..yikes….i only listened to the first couple tracks but is it me or does this ninja’s flow sound like a retard…..seriosuly he sounds like eminem trying to fuck with his voice…………..ex. man down ” if you see hommo in your crib it ain’t a burglery homie/ they fittin to have me stuck in pur-ga-tory ” seriously he sounds like em ” with his ok class ” voice….he is mumbling and slurring his words……but i then stopped listening because i only got the clean version right now and 60 % of the song is bleeped out so i damn sure can’t give an honest opinion on it until then…..

  483. Foekist Says:

    LF: From the shit I been hearing I think Cass will be the sleeper of the year. I been liking all the music he been putting out from “drank and my 2 step” to that shit he got with Fab, even though Fab murked him on his own song.

  484. Foekist Says:

    got it… hood lookin ty

  485. D. Billz Says:

    Foe… What up doe?

    Caught that double feature, 2 for 1 at the movies. Props to the chick from PG keepin’ it hood and remindin’ me that you only need to cop 1 ticket to see 2 movies. Smh… I’m losin’ my touch.

  486. D. Billz Says:

    Foe… Ty… Land…

    What it is?

  487. tyrone biggums Says:

    no doubt foe…..also i just started reading the sports guy article on his top 50 picks for fantasy if you want more info……and the sports guy is always good for comedic value….havent read it yet but i’m sure he is on point as usual….


    * daps billz * whats good homie

  488. landLORD Says:

    How much they payin’ you?


    … family ties … (c) “government” …

    … seriously … he isnt the greatest technical MC in the game, but the production on this lp is topnotch … and Curtis actually tried to switch things up on a couple songs … i too, need the copy with the dirty words in it … an instrumental version of this lp is now top on my wish list …

  489. Foekist Says:

    but i then stopped listening because i only got the clean version right now and 60 % of the song is bleeped out so i damn sure can’t give an honest opinion on it until then…..


    Foekist Says:

    September 1st, 2007 at 10:39 pm
    Shit you might just want parking lot pimp and bang that shit and get all the hoes as the walkin in the spots!! cuzz that aint gone be in the club


    It’s only so much parking lot pimping you can do to the clean version. Especially a fiddy cd.

    Ain’t no way you can be cool knockin some shit like that… mufuckas gon’ be like “where yall cop that cd from, Wal Mart?”

  490. tyrone biggums Says:

    yikes…..i’m a little nervous about the sports guy’s # 3 pick….alexander really ?
    he can comeback all he wants unless guard steve hutchinson comes back he isnt about to recreate 2 seasons ago

  491. D. Billz Says:

    Foekist Says:

    September 2nd, 2007 at 1:06 pm
    LF: From the shit I been hearing I think Cass will be the sleeper of the year. I been liking all the music he been putting out from “drank and my 2 step” to that shit he got with Fab, even though Fab murked him on his own song.

    ^He better be because he pops much shit, with 2 mediocore albums under his belt. The 2nd joint wan’t bad but he had songs like a “Belly Ring” and a couple other fillers that fucked up the flow of the album.

  492. Foekist Says:

    tyrone biggums Says:

    September 2nd, 2007 at 1:11 pm
    no doubt foe…..also i just started reading the sports guy article on his top 50 picks for fantasy if you want more info……and the sports guy is always good for comedic value….havent read it yet but i’m sure he is on point as usual….



    thanks bro

  493. tyrone biggums Says:

    … seriously … he isnt the greatest technical MC in the game, but the production on this lp is topnotch … and Curtis actually tried to switch things up on a couple songs … i too, need the copy with the dirty words in it … an instrumental version of this lp is now top on my wish list …

    …..lmao….yeah i was thinking that yesterday……as i heard the first 3 -5 seconds of each song…i was like well if nothing else he came with a collection of dope instrumentals for me too listen to when i find it

  494. Foekist Says:

    @D Billz

    did you hear the song with him and fab? izzit just me or did fab really kill that song? it wasno way Cass could follow that verse, he should’ve just talked shit or something and not bother rapping. Usually Cass has a couple “how the fuck did he think of that” moments per verse, but Fab whole verse was filled with them

  495. D. Billz Says:

    landLORD Says:

    September 2nd, 2007 at 1:12 pm
    How much they payin’ you?


    … family ties … (c) “government” …

    … seriously … he isnt the greatest technical MC in the game, but the production on this lp is topnotch … and Curtis actually tried to switch things up on a couple songs … i too, need the copy with the dirty words in it … an instrumental version of this lp is now top on my wish list …

    ^Honestly, 6/10. “Peep Show” and “Fire” are two suck-ass songs that he coulda left off of there. “Touch the Sky” was a weak endin’ to the track listin’. “Straight to the Bank”… I never liked. His attempt at West Coast production always have a bad turn-out. Not to forget, I’m judgin’ all this from the edited version. Overall… he and Jay still owe me a gully ass album before their careers are at a halt.

  496. landLORD Says:

    … 1. barry bonds … 2. big brother … 3. the glory … 4. champion … 5. everything i am … 6. flashing lights … 7. good morning … 8. good life …

    … the rest dont matter …

  497. D. Billz Says:

    Foekist Says:

    September 2nd, 2007 at 1:17 pm
    @D Billz

    did you hear the song with him and fab? izzit just me or did fab really kill that song? it wasno way Cass could follow that verse, he should’ve just talked shit or something and not bother rapping. Usually Cass has a couple “how the fuck did he think of that” moments per verse, but Fab whole verse was filled with them

    ^Yeah, Fab kinda roundhoused him on that one. And he’s another whose albums just keep gettin’ worse. He’s great for other peoples’ songs, but can’t make a decent album. Back then, his mean punches made up for his lack of personality. But now, he’s gettin’ redundant with the same party n’ bullshit (c) BIG, anthems.

  498. Foekist Says:

    ty check ur email dunn dunn

  499. D. Billz Says:

    I’m ’bout to start callin’ that flaw Method Man Syndrome: great on everybody elses song but catastrophic album attempts.

  500. Foekist Says:

    D. Billz Says:

    September 2nd, 2007 at 1:26 pm
    I’m ’bout to start callin’ that flaw Method Man Syndrome: great on everybody elses song but catastrophic album attempts.


    wurdup… but i relistened to mef’s last jump off and it got about 4 bangers on it.

  501. D. Billz Says:

    Foekist Says:

    September 2nd, 2007 at 1:27 pm
    D. Billz Says:

    September 2nd, 2007 at 1:26 pm
    I’m ’bout to start callin’ that flaw Method Man Syndrome: great on everybody elses song but catastrophic album attempts.


    wurdup… but i relistened to mef’s last jump off and it got about 4 bangers on it.

    ^But that’s like 4 outta what? 14 joints? That’s a horrible percentage. If you were in a pick-up game and shot 4 outta 14, you might as well forget about being picked up for the next game.

  502. tyrone biggums Says:

    landLORD Says:
    September 2nd, 2007 at 1:24 pm
    … 1. barry bonds … 2. big brother … 3. the glory … 4. champion … 5. everything i am … 6. flashing lights … 7. good morning … 8. good life …

    … the rest dont matter …

    …..homecoming is my shit too…..i ca’t get enough of that beat….

    @ foe – send away

  503. landLORD Says:

    foekist said

    wurdup… but i relistened to mef’s last jump off and it got about 4 bangers on it.


    … Meth’s entire solo catalogue prolly doesnt have more than 3 classic singles … bring the pain … judgement day … ??? …

  504. Foekist Says:

    … Meth’s entire solo catalogue prolly doesnt have more than 3 classic singles … bring the pain … judgement day … ??? …


    I said bangers not classics

  505. tyrone biggums Says:

    landLORD Says:
    September 2nd, 2007 at 1:33 pm
    foekist said

    wurdup… but i relistened to mef’s last jump off and it got about 4 bangers on it.


    … Meth’s entire solo catalogue prolly doesnt have more than 3 classic singles … bring the pain … judgement day … ??? …

    …..all i need…..after that………………………………………………

  506. Foekist Says:

    kanye only got 13 songs?

  507. D. Billz Says:

    I throw a tv at you, crazy (c) scene from Halloween

    That ninja was Shaq size. I like how he can walk just as fast as someone runnin’. Either that, or those slow ass white chicks need to step their game up.

  508. Foekist Says:

    aight I just burned a couple cd”s time to hit the road take it sleazy yall

    big ups to ty for the kanye link

  509. landLORD Says:

    >>> I said bangers not classics


    … i know what you said, POTna … i was just making a statement related to you and DBillz statements …

  510. landLORD Says:

    >>> …..all i need…..after that………………………………………………


    … and that was half Mary … Meth needs helpers …

  511. tyrone biggums Says:

    no doubt foe

  512. D. Billz Says:


    now… it is a pleasure… for you to meet me

  513. tyrone biggums Says:

    … and that was half Mary … Meth needs helpers …

    ……i’d say 50 % mary……40% the beat……10% meth…

  514. D. Billz Says:

    Shyheim > Method Man

    Aint they cousins or some ish?

  515. landLORD Says:

    D. Billz Says:

    September 2nd, 2007 at 1:49 pm
    Shyheim > Method Man


    … cosign … Shyheim had mad potential … jail time is a helluva deterrent …

  516. D. Billz Says:

    landLORD Says:

    September 2nd, 2007 at 1:51 pm
    D. Billz Says:

    September 2nd, 2007 at 1:49 pm
    Shyheim > Method Man


    … cosign … Shyheim had mad potential … jail time is a helluva deterrent …

    ^Word. His first album was better than all of Mef’s combined. And that kid Pop Da Brown Hornet (still a ill name to me) shined on there too. As a matter of fact, if somebody on here got that, then send me the link pronto.

  517. landLORD Says:

    *off to Wally World*

  518. tyrone biggums Says:

    co-sign shyheim

    the lost generation is one of my favorite albums ever….true story……

  519. tyrone biggums Says:

    sorry billz no links to shyheim i bought that shit in like 8th grade and still have it


  520. plug industries Says:

    smh @ landlord for not realizing that run dmc was NEVER signed to def jam.
    yup. ole homo ass russ aint have faith in his bro

  521. It'smesnitches Says:

    D. Billz Says:

    September 2nd, 2007 at 1:40 pm

    now… it is a pleasure… for you to meet me


  522. plug industries Says:

    whats happnin yall- no rerun

    SMH @ me going to church 30 minutes before church closed

  523. OnPoint Says:

    plug industries Says:

    September 2nd, 2007 at 2:03 pm
    whats happnin yall- no rerun

    SMH @ me going to church 30 minutes before church closed

    ^^^SMH at me planning to go to church today, but just waking up now

  524. nation Says:

    >> Aint they cousins or some ish?

    i think… i know that GZA, John Shoja and The RZA are cousins… and that ODB is somehow related to them

  525. OnPoint Says:

    waddup nah

  526. D. Billz Says:

    Plug… snitches… nation… OnPoint (the DJ?)…

    What it is?

  527. OnPoint Says:

    D. Billz Says:

    September 2nd, 2007 at 2:27 pm
    Plug… snitches… nation… OnPoint (the DJ?)…

    What it is?

    ^^Chilling chief…..nah, its a running joke. Im hoping to get into some Mp3 djing soon tho (lol but tru)

  528. D. Billz Says:

    OnPoint Says:

    September 2nd, 2007 at 2:29 pm
    D. Billz Says:

    September 2nd, 2007 at 2:27 pm
    Plug… snitches… nation… OnPoint (the DJ?)…

    What it is?

    ^^Chilling chief…..nah, its a running joke. Im hoping to get into some Mp3 djing soon tho (lol but tru)

    ^Oh iight. Because if you was dukes, you was about to get a online verbal attack about what the fidduck is takin’ so long for MM3 (c) most recent NR Budden post

  529. nation Says:

    >> yup. ole homo ass russ aint have faith in his bro

    >> SMH @ me going to church 30 minutes before church closed

    >> SMH at me planning to go to church today, but just waking up now

    jesus lost

  530. D. Billz Says:

    nation Says:

    September 2nd, 2007 at 2:14 pm
    >> Aint they cousins or some ish?

    i think… i know that GZA, John Shoja and The RZA are cousins… and that ODB is somehow related to them

    ^Didn’t know Shoja was related to ’em.

  531. nation Says:

    >> Chilling chief…..nah, its a running joke. Im hoping to get into some Mp3 djing soon tho (lol but tru)

    yeah okay, just because i exposed you…


  532. hoodtalk.org Says:

    Halloween sucked..thank god i downloaded it…would of felt stupid paying 10 dollars to see it and paying 6 dollars for a soda and 5 dollars for popcorn

  533. D. Billz Says:

    hoodtalk.org Says:

    September 2nd, 2007 at 2:37 pm
    Halloween sucked..thank god i downloaded it…would of felt stupid paying 10 dollars to see it and paying 6 dollars for a soda and 5 dollars for popcorn

    ^You cheated yourself. Some movies are made for big screen because of the effects and camera angles. Them lil’ ass speakers and computer monitor can rob you of the experience. I’m not sayin’ it was great. But it was pretty decent. And the fact that I saw it for free was a good look. The endin’ was “eh” though.

  534. hoodtalk.org Says:

    Why was Michael Myers 7’11”?

    He was big…but never that tall…

  535. $***M-ROC***$ Says:

    “tical” was a straight classic. every tune.

    the wu has the “second album” syndrome. every “first solo album” was fire. tical (meth), return to the 36 chambers (odb), OB4CL (rae), ironman (ghost), liquid swordz (gza)…..ALL their first albums were undeniable classics. the only one who broke out of the first album syndrome was ghost, and to a lesser degree, GZA. meth hasn’t had a good album since the first tical, and neither have any of the others besides ghost.

  536. D. Billz Says:

    hoodtalk.org Says:

    September 2nd, 2007 at 2:42 pm
    Why was Michael Myers 7′11″?

    He was big…but never that tall…

    ^Lol. WORD! I kept makin’ jokes about that while watchin’ it. Shaq couldn’t guard that ninja in the post. And since when did he have super-human strength? I swear, all I could think about was Prodigy’s line from “Keep It Thoro” when he killed that cop…

    I throw a tv at you, crazy

  537. D. Billz Says:

    $***M-ROC***$ Says:

    September 2nd, 2007 at 2:44 pm
    “tical” was a straight classic. every tune.

    the wu has the “second album” syndrome. every “first solo album” was fire. tical (meth), return to the 36 chambers (odb), OB4CL (rae), ironman (ghost), liquid swordz (gza)…..ALL their first albums were undeniable classics. the only one who broke out of the first album syndrome was ghost, and to a lesser degree, GZA. meth hasn’t had a good album since the first tical, and neither have any of the others besides ghost.

    ^Co-sign. What it is?

  538. nation Says:

    >> I kept makin’ jokes about that while watchin’ it. Shaq couldn’t guard that ninja in the post. And since when did he have super-human strength?

    smh @ Rob Zombie

  539. THE-XFACTA Says:

    *News Flash:Women have been offically determined to be the root of all evil*

  540. D. Billz Says:

    nation Says:

    September 2nd, 2007 at 2:55 pm
    >> I kept makin’ jokes about that while watchin’ it. Shaq couldn’t guard that ninja in the post. And since when did he have super-human strength?

    smh @ Rob Zombie

    ^For a ninja who did it all on his own, that was a pretty good effort.

  541. nation Says:

    >> For a ninja who did it all on his own, that was a pretty good effort.

    word… i just saw this too: http://www.youtube.com/watch?v=2HtAS9RY1k8

  542. Big Homie Says:

    I I get it

  543. D. Billz Says:

    Xfacta… BigHomie…

    What it is?

  544. nation Says:

    you guys seen this?


    change will come


    Ya Boy – “I Get Money freestyle”

  546. D. Billz Says:


    September 2nd, 2007 at 3:28 pm
    Ya Boy – “I Get Money freestyle”

    ^My grandmother freestyled over that beat last week.

  547. THE-XFACTA Says:

    The X-Facta-I Get Money freestyle


  548. THE-XFACTA Says:


    That’s a great post !!!!! Fucking RIAA is like Hitler

  549. Big Homie Says:

    Everybody show some love in my blog and be easy. Going to a crab feast for crab and beer *hungover from last night of course*


  550. FuckUPayMe618 Says:

    *daps everybody on board*

    LF is that More Fish worth copping?

  551. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 3:58 pm
    *daps everybody on board*

    LF is that More Fish worth copping?

    ^Nah. But it’s definitely a worthy d/l. His Sun murdered that one beat.

  552. FuckUPayMe618 Says:

    ^Nah. But it’s definitely a worthy d/l. His Sun murdered that one beat

    right on dawg

  553. eskay Says:

    when niggas see hootie and jeter22 tell ’em I’ma fuck they mothers in the ass and toss em over the bride for posting retails. fucking disrespectful bags of goat dung, I hope their kids are born with 9 thumbs.

  554. FuckUPayMe618 Says:

    LMAO ^^^

  555. THE-XFACTA Says:


    eskay Says:

    September 2nd, 2007 at 4:10 pm
    when niggas see hootie and jeter22 tell ‘em I’ma fuck they mothers in the ass and toss em over the bride for posting retails. fucking disrespectful bags of goat dung, I hope their kids are born with 9 thumbs.


    Niggas tryin’ to get you shut down! (c) PE

  556. tyrone biggums Says:

    lmao….i tried warning you eskay…..

  557. FuckUPayMe618 Says:

    I got a liquid swords and lets get free link if anybody want it. n/h holla at me fupayme618@gmail.com

  558. THE-XFACTA Says:


    English Mother Fucker English! (c) Spike Lee Joint

  559. plug industries Says:

    smack em once for me too eskay. dude str8 up posted porn on this bitch wit no warning. I have my kids on here.

  560. THE-XFACTA Says:

    SMH @ Any kid on Nah Right… What happened to the Smurfs? (Gargamyle finally got them)

  561. nation Says:

    >> I have my kids on here.


    man, jokes aside… this Graduation is incredible… i just sent the wifey the lyrics to Flashing Lights and told her to expect to hear from my lawyers

  562. Paperstacker Says:

    why hasn’t hoodtalk been banned

  563. Jeter22 Says:

    Damn, my bad esgay I hought you would have liked the fact that curtis was leaked so ya boy Ye could get the first week numbers edge…

    Anyway no harm no foul….

  564. tyrone biggums Says:

    Paperstacker Says:
    September 2nd, 2007 at 4:34 pm
    why hasn’t hoodtalk been banned

    ……he has been multiple times….he keeps changing his i.p. address so he can just repost again……

    anyone got a link to the dirty version of curtis…i want to check this out before i go to this bar-b-q and i can’t even begin to listen to the clean version….


  565. THE-XFACTA Says:


    Paperstacker Says:

    September 2nd, 2007 at 4:34 pm
    why hasn’t hoodtalk been banned


    “Question of the Day” (c)Sports Center

  566. tyrone biggums Says:

    Jeter22 Says:
    September 2nd, 2007 at 4:35 pm
    Damn, my bad esgay I hought you would have liked the fact that curtis was leaked so ya boy Ye could get the first week numbers edge…

    Anyway no harm no foul….

    ……dumb ass posting retails on here is how this site gets shut the fuck down…..and how does this give kanye and edge considering kanye leaked ( nhoc ) before curtis…..

  567. nation Says:

    ty… go easy on the gully juice

  568. tyrone biggums Says:

    nation Says:
    September 2nd, 2007 at 4:42 pm
    ty… go easy on the gully juice

    …….lmao…..you mean this vitamin water ?…..

  569. nation Says:

    >> ty… go easy on the gully juice

    what am i saying… it’s dumb out season… go nuts go apeshit

  570. plug industries Says:

    “Question of the Day” (c)Sports Center
    yo anybody remember that dipset mixtape when they used that beat? man that was classic

  571. tyrone biggums Says:

    nation Says:
    September 2nd, 2007 at 4:47 pm
    >> ty… go easy on the gully juice

    what am i saying… it’s dumb out season… go nuts go apeshit

    ….you already know…..

  572. nation Says:

    Big Brother saw me at the bottom of the totem
    Now I’m on the top and everybody on the scrotum

    Have you ever walked in the shadow of a giant?
    Not only a client, the Presidito… HOLA HOVITO


  573. plug industries Says:

    SMH @ my internet that I’m payin for only working for a total of 3 days since they hooked it up. it took em 5 weeks to get it to work for that couple of days. in conclusion…:

    my neighbors wireless unsecured internet > my internet

  574. plug industries Says:

    Big Brother saw me at the bottom of the totem
    Now I’m on the top and everybody on the scrotum
    that beat is sickning… dam.

  575. plug industries Says:

    although That kanye is fire, the title of the hottest tape of the year still goes too……..

    Prodigy- Return of the mac

  576. 456 Says:

    Prodigy- Return of the mac

    ^you got that plug? i left my copy in my car in fuckin zambia

  577. plug industries Says:

    ^you got that plug? i left my copy in my car in fuckin zambia
    i got it. I cant up it though. my internet is down and my neighbors net is slow as molassis in the winter time

  578. nation Says:

    >> my neighbors wireless unsecured internet > my internet

    unsecured connections run leaner than protected ones… problem is unless you get unlimited… you get fruuckked

  579. plug industries Says:

    unsecured connections run leaner than protected ones… problem is unless you get unlimited… you get fruuckked
    …english please…

  580. nation Says:

    >> …english please…


  581. plug industries Says:

    >> …english please…

    I still dont get it. Im slow today….

    but dam that song was tight. what album is that on

  582. That Man Says:

    Breaking News:

    Kids are perfecting their English from NahRight.

    Write “What it is, homies?” on chalkboard a thousand times.

    *does the Soulja Boy dance on the blacktop*

  583. nation Says:

    >> Kids are perfecting their English from NahRight.


  584. THE-XFACTA Says:

    The-XFacta’s Offical 9.11.07 Leaked Album Rankings:

    1. Soulja Boy-Superman Dat Hoe
    2. Da Band-Unreleased Hits
    3. Heather Hunter-I Blow on Two Mics
    4. 50 Cent-Curtis
    5. Kayne West-Graduation

  585. That Man Says:

    >>1. Soulja Boy-Superman Dat Hoe



    Leave them kids alone!

  586. plug industries Says:

    I swear to God I was at the club yesterday and that soulja boy song came on. the place went bunkers. I hate that fuckin song. maybe if he didnt mentiion bape so much I could tolerate it. everybody snappin they fingers and shit. I was mad at xfacta yesterday when he said souja boy was woth check out. I just seen the post that he was joking. my apologies

  587. hoodtalk.org Says:

    nation Says:

    September 2nd, 2007 at 5:07 pm
    >> my neighbors wireless unsecured internet > my internet

    unsecured connections run leaner than protected ones… problem is unless you get unlimited… you get fruuckked

    ^fucking computer nerd…i bet you lost your virginity on eharmony.com…huh..

    i use to pick on computer nerds just like you all through high school

  588. plug industries Says:

    I know you aint talkin bout me. you been on my bad side since you been on here. specially after you posted hardcore porn on here. my kids be on this site. watch what you say, do, and think from now on… please take me seriously

  589. hoodtalk.org Says:

    I’m sorry plug I didn’t mean to post porn while your kids were here. I hope they didn’t watch it. How old are they?

    I posted the porn at nightime…thinking the adult audience was going to be here..

    I apologize man…I didn’t mean it…

  590. plug industries Says:

    fall back

  591. nation Says:

    >> i use to pick on computer nerds just like you all through high school

    until what? you would fail and they would succeed? and then what… they became your boss and you had a fall back attack… apologizing for shit, sorta like this:

    I’m sorry
    I didn’t mean to
    I hope they
    I apologize man…
    I didn’t mean it…

    and you’re a fucking idiot if you think a wireless internet connection is incomprehensible… you’re a slave to my dial-tone

  592. Furiou$tylez...I'm So Chicago Says:

    am i the only one who likes “drunk and hot girls?”

    that shit is on repeat in the car…

    *daps anybody in attendence*

  593. nation Says:

    when nahggers see bootleg blanket tell him I’ma fuck his mother in the ass and toss her over the bridge for posting the retail to Blu & Exile’s Below The Heavens. fucking disrespectful bag of goat dung, I hope his kids are born with 9 thumbs.


    oh, and also for posting all those joe budden songs in the Happy Birthday Joe Budden post… and also for posting that Black Moon Instrumental cd in the Like a Star post… motherfucker

  594. benhameen Says:


    whats up to everyone. Jamie Foxx was not lying when he said Africa is Full of Halle Berrys..its fucking bananas over here. You cant turn your head without seeing what would easily be considered a dime in the states. Too bad the HIV rates are just as incredible. Your boy is chilling for his first week until I see whats what. But rest assured Im coming home wit stories to tell. whenever that is I may stay over here for a goooooooooooooooood minute….

  595. benhameen Says:

    Peace and good night to all from the eastern hemisphere. gonna do some real talk on me blog tommorow. Love to all be good to each other.

  596. benhameen Says:

    and uh late pass but Eskay thanks for the UPS is hiring joint. when the asian dude did the puffy dance I almost cried….

  597. D. Billz Says:

    plug industries Says:

    September 2nd, 2007 at 5:00 pm
    although That kanye is fire, the title of the hottest tape of the year still goes too……..

    Prodigy- Return of the mac

    ^Agreed. Best play off words…

    … and we aint talkin’ bout pimpin, bitch

  598. D. Billz Says:

    Someone need ROTM?

    “tell 456 Steph to holla at me mannnnn (c) Camel talkin’ on “Best Of Me” feat. Rat Girl


    LF: Smh @ me havin’ bandanas to match everything during the time period of this video.

    Leslie Pridgen’s freestyle over “Best Of Me” > Shawn Carter’s original verse on “Best Of Me”

    that’s high school, makin’ me chase you around wit’ pumps…

  599. nation Says:

    >> “tell 456 Steph to holla at me mannnnn (c) Camel talkin’ on “Best Of Me” feat. Rat Girl

    tell Stoute… Steve Stoute

    >> Leslie Pridgen’s freestyle over “Best Of Me” > Shawn Carter’s original verse on “Best Of Me”

    Dwayne Carter’s freestyle over Best of Me > used to wheelie bicycles since i was six

  600. D. Billz Says:

    nation Says:

    September 2nd, 2007 at 8:24 pm
    >> “tell 456 Steph to holla at me mannnnn (c) Camel talkin’ on “Best Of Me” feat. Rat Girl

    >>tell Stoute… Steve Stoute

    ^Ahhhh. Makes sense to me now. This is like my 3rd mishap with tryin’ to figure out Camel shoutouts.

    DeHaven lost

    >> Leslie Pridgen’s freestyle over “Best Of Me” > Shawn Carter’s original verse on “Best Of Me”

    >>Dwayne Carter’s freestyle over Best of Me > used to wheelie bicycles since i was six

    ^Lies. And he need his ass kicked for pickin’ to flow over that beat years later. Smh @ some herb diggin’ the crates Mp3 files to find EVERY song their “idol” (read: surrogate father) freestyled/rapped over.

  601. nation Says:

    >> Lies.

    nah jay’s was obviously better, but Wayne’s version was heat

  602. D. Billz Says:

    nation Says:

    September 2nd, 2007 at 8:36 pm
    >> Lies.

    nah jay’s was obviously better, but Wayne’s version was heat

    ^ having bad credit > giving Wayne credit

    And I haven’t even heard it.

  603. G7 Says:

    EarDrum > Graduation

  604. D. Billz Says:

    G7… What it is? Yo, you get EarDrum in the stash by any chance?

  605. EnglandRepresent Says:

    Whats the dilly Nahggers? Whats the crack?

    Fuckin Monday mornin, got a hangover, got a massive report to write but I’ve spent all mornin so far laughin my ass off at photoshop pics of Hooters and Greenie’s subsequent ethering of him(nhjic), have’nt done feck all of this report, and I gotta go see my girl at lunchtime and break the bad news that I’m kickin her ass to the curb. Fuckin Mondays.

  606. THE-XFACTA Says:

    *Daps Eng Rep, TelephoneBillz*

  607. G7 Says:

    whudup Billz?

    I don’t have Eardrum on my PC. I got the cd. I’d rip it and send it to you, but my cd drive is fried. It won’t detect any discs so I can’t listen to or burn anything. Got a new PC on the way, but won’t be here til late next week.

  608. D. Billz Says:

    Xfacta… EngRep…

    What’s da deal?

    @ Xfacta… yo, you need to up’ that Bossman “Can’t Tell Me Nothin” freestyle. Lava.

  609. G7 Says:

    X, Eng, what’s crackulatin’

  610. EnglandRepresent Says:

    What up X? Whats that weekend been like in the BX? Summer comin to an end for you NYers?

  611. ODEMIC Says:

    Sup everybody. I’m at work late… Bumpin’ that Scarface ‘Never’. Dude’s got a real deep expressive voice. Its like you can feel the pain somewhere when he spits.

    Anyhow, been MIA, what’d i miss?

  612. EnglandRepresent Says:

    What up G Funk, Billy?

    Shit, I gotta give my girl the boot in about an hour. Not lookin forward to it.

  613. G7 Says:

    whudup Odemic? u missed the usual….kanye/curtis talk, so you haven’t miss too much. maybe a couple album links here and there…lol.

  614. D. Billz Says:

    G7 Says:

    September 2nd, 2007 at 9:27 pm
    whudup Billz?

    I don’t have Eardrum on my PC. I got the cd. I’d rip it and send it to you, but my cd drive is fried. It won’t detect any discs so I can’t listen to or burn anything. Got a new PC on the way, but won’t be here til late next week.

    ^Word. Good lookin’ out anyway though.

  615. green eyes Says:

    # EnglandRepresent Says:
    September 2nd, 2007 at 9:20 pm

    Whats the dilly Nahggers? Whats the crack?

    Fuckin Monday mornin, got a hangover, got a massive report to write but I’ve spent all mornin so far laughin my ass off at photoshop pics of Hooters and Greenie’s subsequent ethering of him(nhjic), have’nt done feck all of this report, and I gotta go see my girl at lunchtime and break the bad news that I’m kickin her ass to the curb. Fuckin Mondays.

    ^^LMAO. what up eng

  616. D. Billz Says:

    EnglandRepresent Says:

    September 2nd, 2007 at 9:37 pm
    What up G Funk, Billy?

    Shit, I gotta give my girl the boot in about an hour. Not lookin forward to it.

    ^Dumpin’ her?

  617. EnglandRepresent Says:

    *Issues dap to ODEMIC*

    Scarface is ridic. That joint he dropped last year, ‘The Product’ was slept on.

  618. G7 Says:


    I watch Totts and Fulham yesterday. What an ill game. Your boys really f#$ked up. Up 3-1 and let Fulham tie it up 3-3….smh. Sick game though. Great goals!!

  619. ODEMIC Says:

    Billz, whatup.

    G7: Wildest shit happened to me last night man. I been fuckin’ this journalist at work for the past 3 months, and only last night realised she’s DL Hoe(as most of ’em are anyways). Shit’s annoyin’ B. I was actually tryin'(and failing) to fuck her alone.

  620. ODEMIC Says:

    *Daps EngReppa*

    I was just thinkin’ back to when DMX said on Backstage that Jay and Face were his favorite Lyricists or sum like that. Dude got a sick flow, and his words are to the point yet they hit hard.

  621. G7 Says:

    @ Billz

    drop your e-mail. I found something.

  622. G7 Says:

    >>G7: Wildest shit happened to me last night man. I been fuckin’ this journalist at work for the past 3 months, and only last night realised she’s DL Hoe(as most of ‘em are anyways). Shit’s annoyin’ B. I was actually tryin’(and failing) to fuck her alone.

    lol, better luck next weekend homie.

  623. D. Billz Says:

    ODEMIC Says:

    September 2nd, 2007 at 9:42 pm
    Billz, whatup.

    G7: Wildest shit happened to me last night man. I been fuckin’ this journalist at work for the past 3 months, and only last night realised she’s DL Hoe(as most of ‘em are anyways). Shit’s annoyin’ B. I was actually tryin’(and failing) to fuck her alone.

    ^lol @ Odemic. What’s good chief? Smashin’ journalists? Damn, I need to step my professional chicks game up.

    @ G7… dtb7881@hotmail.com

  624. G7 Says:

    Curtis….nightmare lyrically, but got some tuff beats on it.

  625. crazy88SINCE88 Says:

    ….THAT DAMN SUPERMAN RETURNS IA A GOOD DAMN MOVIE… i gotta go 2 my moms & dig up all my old comicbooks!!!

    (88 sings Superman theme song)

    *Duaaaaa’Dn’Dn’Dn’Dnnnnnnnn, DUAAAAA’ Dn’Dn’Dnnnnn*

  626. crazy88SINCE88 Says:

    (does 2 lines of Coke)

    *rips T-Shirt*

    (jumps off Roof, Curls, Tucks, Rolls, Jumps Back in window)

  627. EnglandRepresent Says:

    Yep Billy givin her the ol’ brush off. And as Greenie knows I’m crap at it. I’ve been tryin to dump her for about a week now but have been too pussy to do it. Today’s the day though. Thing is, I’m not even sure why I’m doin it now.

    What up Greenie? How are ya sugarplum?

  628. green eyes Says:

    anyone else ever catch that ice road truckers show on the history channel? interesting

  629. crazy88SINCE88 Says:

    green eyes Says:

    September 2nd, 2007 at 9:54 pm
    anyone else ever catch that ice road truckers show on the history channel? interesting

    i caught the VAPORS!

    (does Biz Mark Dance)

  630. D. Billz Says:

    crazy88… What it is?

  631. ODEMIC Says:

    lol, better luck next weekend homie.

    ^lol, this is the same chick i fucked in the back of my car that i was tellin you bout…fuck her.

  632. Paperstacker Says:

    THAT DAMN SUPERMAN RETURNS IA A GOOD DAMN MOVIE… i gotta go 2 my moms & dig up all my old comicbooks!!!

    Batman Begins>Any Superhero movie

    What up 88, G7, Billz, OD, Erep, Facta, nation, Greeny, and the rest. Whats good.

  633. Game Over Says:

    @ x-facta,

    i ain’t waiting for sh!t, i don’t even live in brooklyn. my point is, kweli is always going on and on about how people need to do more than vote to help the community (he mentions this again in the rather weak ‘express yourself’ remake linked above), but his corny ass isn’t doing a thing to help people in BK. but the so-called negative rapper (50) is. it’s retarded. sure, 50 has more money, but that means that kweli should be doing about 1% of what 50 is doing. instead, he does…nothing. so, dude doesn’t vote OR help the community. he just raps about how *other* people need to help. wtf?

  634. crazy88SINCE88 Says:

    D. Billz Says:

    September 2nd, 2007 at 9:56 pm
    crazy88… What it is?

    *daps The Mayor*
    …aint shit… @ home workin & waitin for Entourage to come on. Just Saw Superman Returns, DAMN Good Movie, im a Comic Movie Fan anyway… i gotta get the WS DVD, ASAP!

  635. green eyes Says:

    What up Greenie? How are ya sugarplum?

    ^ im lovely darlin. wishing i changed the cell # more often than never though. im on my way to a BBQ this afternoon, running late, cell rings, thought it was the party host, so i just answer it “im on my way” got some random mofo i went out with 2 or 3 times a years replying “really? thats what i was hoping for.” SMH.

  636. crazy88SINCE88 Says:

    *daps toiletPAPER*

  637. EnglandRepresent Says:

    I watch Totts and Fulham yesterday. What an ill game. Your boys really f#$ked up. Up 3-1 and let Fulham tie it up 3-3….smh. Sick game though. Great goals!!

    ^^We need Ledley King and Dawson back in the centre of defence. How the fuck do you end up 3-3 when you dominated the whole game. We need something G cos our season is sliding away from us fast.

    Smashin’ journalists? Damn, I need to step my professional chicks game up.

    ^^My bint (soon to be ex) is a Senior Accountant. Shit….

  638. green eyes Says:

    what up crazy, paper

  639. crazy88SINCE88 Says:


  640. ODEMIC Says:

    ^lol @ Odemic. What’s good chief? Smashin’ journalists? Damn, I need to step my professional chicks game up.

    >LOL, yeah billy, i sex for success, lol.

    My computer is loadin’ hella slow man, i’m way outta the topic. Its takin’ a week to refresh…

  641. ODEMIC Says:

    Sup greenie, crazy, paper. WHAT WHAT!!!

  642. EnglandRepresent Says:

    im lovely darlin. wishing i changed the cell # more often than never though. im on my way to a BBQ this afternoon, running late, cell rings, thought it was the party host, so i just answer it “im on my way” got some random mofo i went out with 2 or 3 times a years replying “really? thats what i was hoping for.” SMH.

    ^^lmfao!! Shiiiiiiiit Greenie, thats some random ish. You need to be a bit more stingy with the cell number. I had some slapper ringin me every Saturday night/Sunday mornin at about 3am every weekend for about 5 weekends askin if she could come round to the spot. smh @ wenches with no self respect. Thing is I woulda handled that if she didn’t have a face like a busted asshole.

  643. EnglandRepresent Says:

    What up Crazy?

  644. G7 Says:

    >>What up 88, G7, Billz, OD, Erep, Facta, nation, Greeny, and the rest. Whats good.

    ^whudup paper, also crazy & greens

  645. G7 Says:


    check ya e-mail

  646. FuckUPayMe618 Says:

    wat up g7,EngRep,CS88,Green I’s,Billz,odemic,game over,P.stack

  647. D. Billz Says:

    Game Over Says:

    September 2nd, 2007 at 9:58 pm
    @ x-facta,

    i ain’t waiting for sh!t, i don’t even live in brooklyn. my point is, kweli is always going on and on about how people need to do more than vote to help the community (he mentions this again in the rather weak ‘express yourself’ remake linked above), but his corny ass isn’t doing a thing to help people in BK. but the so-called negative rapper (50) is. it’s retarded. sure, 50 has more money, but that means that kweli should be doing about 1% of what 50 is doing. instead, he does…nothing. so, dude doesn’t vote OR help the community. he just raps about how *other* people need to help. wtf?

    ^I overstand agree with what you’re sayin’. But from the perspective of how you put it, it evens out. What Talib can’t give in monetary gifts, he makes up for by givin’ in the recordings in his music. Talib doesn’t even make a 1/8 of what 50 makes so he can’t afford to just designate time for a cause when he needs that time to record and do shows. So instead of physically being there with the youth, he offers socially conscience music. 50, on the other hand, is at a point where he has to financially maintain a lifestyle now by, unfortunately, makin’ bullshit ass music for record sales. Now that he’s in the “trap” (read: corporate fuckery), he can’t go back to even doin’ street albums, let alone a conscience song. Therefore he gives back by physically being there or donating money to a cause when he gets the chance. And I’m sure he feels that he owes that money because he came from the same struggle.

    And it’s funny that you mention Talib/50 for comparison because they’ve been connected on diff. levels (i.e. Talib interviewin’ 50 for XXL; Talib at G-Unit parties and allegedly gettin’ slapped by his ex-girl, lol).

  648. green eyes Says:

    G7, odemic– whats up

    eng– i know i know, had i not been in a rush i would have checked the caller id and let it go to voicemail.

  649. FuckUPayMe618 Says:

    Batman Begins>Any Superhero movie

    ^^^I heard that the joker is suppose to be in the next batman movie. I saw an ad just can’t remember where

  650. hoodtalk.org Says:

    Does anybody have the Curtis DIRTY ALBUM?

    I need that like a fiend need crack…Like a Hoe a need Dick…

  651. D. Billz Says:

    PStacker… FUPM618…

    What it is?

    @G7… Good lookin’ out chief.

  652. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:12 pm
    Batman Begins>Any Superhero movie

    ^^^I heard that the joker is suppose to be in the next batman movie. I saw an ad just can’t remember where

    ^I hope so. I wonder who’s gonna play the new Joker? But anyway, Batman Begins is a beast, just based off the addition of ninjitsu to his arsenal (which makes sense if you do your homework) and the political undertones.

  653. FuckUPayMe618 Says:

    Does anybody have the Curtis DIRTY ALBUM?

    I need that like a fiend need crack…Like a Hoe a need Dick

    ^^don’t think it leaked. 50 starting the album off on the right foot. He lost focus towards the middle/end of it

  654. Phuque Says:

    *pops in Nah with Henny XO bottle* (nh)

    *pours everybody a shot…except Hootie*

    *gives Hootie bitch beer instead*

    *daps everyone*

    My bday is @ 12:00pm….hold on to those shots ’til then.

    *nigga vanish*

  655. nation Says:

    party n bullshit n party n bullshit n party n bullshit n party n bullshit

  656. FuckUPayMe618 Says:

    smh@ myself for breaking my treo. I lost

  657. nation Says:

    >> Like a Hoe a need Dick…

    lemme find out Twan is going to Phuque’s party and Hootie wasn’t invited

  658. D. Billz Says:

    nation Says:

    September 2nd, 2007 at 10:19 pm
    party n bullshit n party n bullshit n party n bullshit n party n bullshit

    *does retro Puffy dance*

  659. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:20 pm
    smh@ myself for breaking my treo. I lost

    ^How yall ninjas be breakin’ $300 gadgets? Sheeeeit…

  660. Paperstacker Says:

    I heard that the joker is suppose to be in the next batman movie. I saw an ad just can’t remember where


    Yeah its been confirmed the Joker will be in the next movie. He’ll be played by some dude named Heath Ledgar. I think Jack was the best joker though. Theres a teaser trailer at http://www.tinyurl.com/ywzeu7

  661. FuckUPayMe618 Says:


    top ten NBA fights.lol @ num 7

  662. FuckUPayMe618 Says:

    ^How yall ninjas be breakin’ $300 gadgets? Sheeeeit…

    ^^^^Playing spades I repeat I lost

  663. green eyes Says:

    happy almost birthday phuque!

    FuckU– which one did you have? im looking into upgrading to one

  664. FuckUPayMe618 Says:

    FuckU– which one did you have? im looking into upgrading to one

    750 w/cingular

  665. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:25 pm

    top ten NBA fights.lol @ num 7

    ^Smh @ Zo and “Grandma-ma” fightin’. Those dudes were damn near inseperable when they played together on the Charlotte Hornets.

  666. FuckUPayMe618 Says:

    ^Smh @ Zo and “Grandma-ma” fightin’. Those dudes were damn near inseperable when they played together on the Charlotte Hornets

    co-sign Didn’t lj needs start fucking up or some ish

  667. Paperstacker Says:

    top ten NBA fights.lol @ num 7


    lol @ number 10, hahaa, that sih was sissified

  668. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:27 pm
    ^How yall ninjas be breakin’ $300 gadgets? Sheeeeit…

    ^^^^Playing spades I repeat I lost

    ^smh @ slammin’ the duece of spades on the table… only for your book to get taken by the lil’ joker whilst breakin’ ur phone in the process.

  669. FuckUPayMe618 Says:

    Yo greenie if you with sprint the newest one they have is the 755 it runs palm not windows

  670. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:33 pm
    Yo greenie if you with sprint the newest one they have is the 755 it runs palm not windows

    ^Boooooooo @ Palm. I used to work for them. They had a kiosk set-up in the mall. I swear, so much felonious shit went down those few months. Lol

  671. green eyes Says:

    # FuckUPayMe618 Says:
    September 2nd, 2007 at 10:33 pm

    Yo greenie if you with sprint the newest one they have is the 755 it runs palm not windows

    ^ im w. cingular. or att rather, but i’ll go w/ whoever gives me the best deal. the cat at the electronics store said sprint had faster internet

  672. FuckUPayMe618 Says:

    smh @ slammin’ the duece of spades on the table… only for your book to get taken by the lil’ joker whilst breakin’ ur phone in the process.

    Losing to females suck. Man i feel stupid i aint even got a back up phone. I never got a house phone bc most mofos called the celly.

  673. FuckUPayMe618 Says:

    ^ im w. cingular. or att rather, but i’ll go w/ whoever gives me the best deal. the cat at the electronics store said sprint had faster internet

    ^^ i guess it depends my apt is right around the corner from a at&t tower so i was good.

    ^Boooooooo @ Palm. I used to work for them. They had a kiosk set-up in the mall. I swear, so much felonious shit went down those few months. Lol

    ^^^ lol cosign I worked at tmobile in HS mann everybody at school had a celly

  674. plug industries Says:

    top ten NBA fights.lol @ num 7
    how was this not number one?


  675. FuckUPayMe618 Says:

    im w. cingular. or att rather, but i’ll go w/ whoever gives me the best deal. the cat at the electronics store said sprint had faster internet

    ^^^i think sprint’s data plans are cheaper.

  676. plug industries Says:

    bill lambeer + george blahah= greatest comintators ever

  677. FuckUPayMe618 Says:

    top ten NBA fights.lol @ num 7
    how was this not number one?


    ^^ i think that was before the pace/piston brawl

  678. D. Billz Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:37 pm
    smh @ slammin’ the duece of spades on the table… only for your book to get taken by the lil’ joker whilst breakin’ ur phone in the process.

    Losing to females suck. Man i feel stupid i aint even got a back up phone. I never got a house phone bc most mofos called the celly.

    ^Took a L to some chicks? Waaaooow. Yo, I swear they be cheatin’. Chicks spades game be on point when they got a homegirl as a partner.

  679. plug industries Says:

    Ron artest is such a bitch. dude was scared of ben wallace so he charges at a skinny white dude wit glasses. and what makes it so bad is dude still has a brew in his hand

  680. FuckUPayMe618 Says:

    Took a L to some chicks? Waaaooow. Yo, I swear they be cheatin’. Chicks spades game be on point when they got a homegirl as a partner.

    ^^No Doubt mofos be having card tournaments with trohpy’s and everything round here. I need to come up on some doe A.S.A.P anybody down for some e-dice.

  681. green eyes Says:

    ^Took a L to some chicks? Waaaooow. Yo, I swear they be cheatin’. Chicks spades game be on point when they got a homegirl as a partner.

    ^ dont be salty that women are better than you

  682. D. Billz Says:

    green eyes Says:

    September 2nd, 2007 at 10:51 pm
    ^Took a L to some chicks? Waaaooow. Yo, I swear they be cheatin’. Chicks spades game be on point when they got a homegirl as a partner.

    ^ dont be salty that women are better than you

    ^Heffas be cheatin’. Lil’ secrets n’ shit they be havin’ before the game.

  683. FuckUPayMe618 Says:

    Ron artest is such a bitch. dude was scared of ben wallace so he charges at a skinny white dude wit glasses. and what makes it so bad is dude still has a brew in his hand

    ^^^^Ben Wallace = Kimbo Slice Ron aint stupid

  684. crazy88SINCE88 Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:12 pm
    Batman Begins>Any Superhero movie

    ^^^I heard that the joker is suppose to be in the next batman movie. I saw an ad just can’t remember where

    (88 returns)
    …Yes, The Joker WILL be in “The Dark Knight”, the movie will me 2’x’s better than Bat.Begins…

    Daps all in the room, G7, GreenBean, FuckU, Plug, Eng, Nate, The Jap…

  685. green eyes Says:

    ^Heffas be cheatin’. Lil’ secrets n’ shit they be havin’ before the game.

    ^ its called STRATEGY. you go in w/out a plan you got out losing

  686. crazy88SINCE88 Says:

    FuckUPayMe618 Says:

    September 2nd, 2007 at 10:53 pm
    Ron artest is such a bitch. dude was scared of ben wallace so he charges at a skinny white dude wit glasses. and what makes it so bad is dude still has a brew in his hand

    ^^^^Ben Wallace = Kimbo Slice Ron aint stupid

    Ben Wallace’ll Kick AI’s ass… Ben Wallace look like he Throw Spears @ Lions & shit back home.

  687. Phuque Says:


    >>The Jap…


    Whaddup fam.

    @ greens – thank you…I’m off to celebrate – hollaattaplayawhenyaseemeintheskreet….

  688. FuckUPayMe618 Says:

    Ben Wallace’ll Kick AI’s ass… Ben Wallace look like he Throw Spears @ Lions & shit back home

    ^^^co-sign lol i woulda whooped the ref’s ass to avoid fighting that ni66a

  689. D. Billz Says:

    Artest didn’t even have a beef with Wallace. He was just heated over the call. He shoulda went after the fan and had every right to. Yall ninjas in the D don’t know how to act.

  690. FuckUPayMe618 Says:

    Heffas be cheatin’. Lil’ secrets n’ shit they be havin’ before the game.

    ^ its called STRATEGY. you go in w/out a plan you got out losing

    ^^^it was a conspiracy. Now i got a broke PDA with a whole in my wall.

  691. plug industries Says:

    Ben Wallace = Kimbo Slice


  692. crazy88SINCE88 Says:

    Phuque Says:

    September 2nd, 2007 at 10:58 pm

    >>The Jap…


    Whaddup fam.

    aint shit, collllllllllld chillin, like Marley Marl.

  693. FuckUPayMe618 Says:


    ^^^its all good next week im at church.

    Im out got a piece coming through in a few. Peace

  694. crazy88SINCE88 Says:

    im from jersey, LOVE jersey, but applaud wvery muthafucka who goes to the shore… the water looks like dog piss.

  695. plug industries Says:

    Artest didn’t even have a beef with Wallace. He was just heated over the call. He shoulda went after the fan and had every right to. Yall ninjas in the D don’t know how to act.
    lol & smh. ben muffed artest in the face… if anybody he shoulda been swingin on it was ben. then the nigga gonna disrespect us by putting his feet on the “coffee table”. I woulda thru my beer on him too… on second thought, i woulda thru your beer on him. i aint waistin good booze

  696. FuckUPayMe618 Says:


  697. FuckUPayMe618 Says:


  698. plug industries Says:


  699. Paperstacker Says:

    Ron artest is such a bitch. dude was scared of ben wallace so he charges at a skinny white dude wit glasses. and what makes it so bad is dude still has a brew in his hand


    How is he a bitch? Wallace just pushed him back, he aint even muff his face. Artest was being smart trying to diffuse the situation and avoid suspension. At that point Wallace would already have endured a suspension and a fine. All the players hopped in to stop it before Artest could even through a punch. It would have been stupid to try and go after Wallace.

    However after falling back for the sake of avoiding suspension and all the other bullshit how would u feel if some white boy in the stands through a cup of beer for no reason, while you were lying on the table, on your face like you were like some piece of shit. I would have been even more angry.

  700. D. Billz Says:

    plug industries Says:

    September 2nd, 2007 at 11:07 pm
    Artest didn’t even have a beef with Wallace. He was just heated over the call. He shoulda went after the fan and had every right to. Yall ninjas in the D don’t know how to act.
    lol & smh. ben muffed artest in the face… if anybody he shoulda been swingin on it was ben. then the nigga gonna disrespect us by putting his feet on the “coffee table”. I woulda thru my beer on him too… on second thought, i woulda thru your beer on him. i aint waistin good booze

    ^lmao. What da fidduck is the “coffee table”? The sideline table? Fuck yo table ninja (c) Rick James

  701. D. Billz Says:

    *ninja vanish*

  702. plug industries Says:

    how would u feel if some white boy in the stands through a cup of beer for no reason, while you were lying on the table, on your face like you were like some piece of shit. I would have been even more angry.
    if he wouldve manned up and scrapped wit ben none of it woulda happened. instead he fought a man armed wit a beer.

    Newsflash Artest: if the guy still had a beer in his hand, maybe he didnt throw it.

  703. plug industries Says:

    GOD DAM!!!


  704. plug industries Says:

    ^lmao. What da fidduck is the “coffee table”? The sideline table? Fuck yo table ninja (c) Rick James
    LOL. im 5000

  705. EnglandRepresent Says:

    Shiiiiiiiiit, bollocks, fuck, bollocks, fuck, shit, fuck, bollocks, shit, fuck, bollocks.

    smmfbah @ myself.

    *slams head on computer table*

    *picks own head up*

    *slaps himself, back-handed, naturally*

    How in the fuck did I just come back from a break up meeting with my girl, having not broken up? EnglandRepresent = the embodiment of the word dickhead.

  706. EnglandRepresent Says:

    Damn my girl for puttin on the mini-dress. I never had her down for a triflin biznitch but she knew damn well that we were gonna be havin ‘the talk’ today and she fuckin rolls up in a mini-dress lookin fly as fuck. She knew damn well I could’nt kick that to the curb. Shit. Pussy will do strange things to a dude.

  707. D. Says:

    Damn my girl for puttin on the mini-dress.


  708. 456 Says:

    Damn my girl for puttin on the mini-dress. I never had her down for a triflin biznitch but she knew damn well that we were gonna be havin ‘the talk’ today and she fuckin rolls up in a mini-dress lookin fly as fuck. She knew damn well I could’nt kick that to the curb. Shit. Pussy will do strange things to a dude.

    ^smh…what you could do is…you could BE A MAN!!! (c) brando as the godfather

  709. 456 Says:

    Damn my girl for puttin on the mini-dress.



  710. EnglandRepresent Says:


    ^^You’d be lucky you ol’ pervin ass ninja.

    smh…what you could do is…you could BE A MAN!!! (c) brando as the godfather

    ^^456, at this stage I don’t need chastisement I need understanding (nhjic – for all you sexually confused computer gimps)…the wench looked RIGHT. What was I gonna do?

  711. EnglandRepresent Says:

    Damn my girl for puttin on the mini-dress.




  712. D. Says:



    ^^damn eng, didn’t know you were into beastiality… the weirdos on this site, i swear… smh

  713. 456 Says:

    ^^456, at this stage I don’t need chastisement I need understanding (nhjic – for all you sexually confused computer gimps)…the wench looked RIGHT. What was I gonna do?

    ^LOL…sorry england. i just never miss an opportunity to use that line…

  714. EnglandRepresent Says:

    ^^damn eng, didn’t know you were into beastiality… the weirdos on this site, i swear… smh

    ^^smh as if you have’nt ever put your hands on a tasty looking highland Yak.

  715. D. Says:

    the wench looked RIGHT.

    >>*thinks medieval times, snowbunnies w/ pigtails, short skirts and titties served up* yeah, I can relate… as long as you get to smash at least once more, you made the right call

  716. EnglandRepresent Says:

    ^LOL…sorry england. i just never miss an opportunity to use that line…

    ^^Yeah, yeah!! Whats good anyways chieftain?

  717. D. Says:

    ^^smh as if you have’nt ever put your hands on a tasty looking highland Yak.

    >>lol… sorry mang, anytime I think of yak (no Hennessey) I think of ren & stimpy. “…our yaks are very large, and they smell like rotting beef carcasses”

  718. D. Says:

    we go through too much bullshit just to mess w/ these…


    song of the weekend…

  719. EnglandRepresent Says:

    as long as you get to smash at least once more, you made the right call

    ^^I think so bruh. The bint is a dime no doubt I’m just fickle as fuck and I’ve got commitment issues……

  720. EnglandRepresent Says:

    smh @ me talkin about ‘commitment issues’ on Nahggers

    *backhand slaps self again*

    *tells self to harden the fuck up (nh)*

    *self-chastising crickets*

  721. EnglandRepresent Says:

    I’m outski.

    From out the blue just got two tickets to go to a runway show for the Spring Fashion Event. Free champagne, bitches in no clothing, I got a spare ticket…anyone?

  722. EnglandRepresent Says:


  723. EnglandRepresent Says:

    *chuckles at himself*

    Funny ol’ fucker I am.

    *looks around realises is talkin to himself again*

    Right I’m off to the fashion show to see some pink bits.

    Peace Nahggers

  724. nation Says:

    no more Entourage until June 08th?

    we need a board

  725. Frank White Says:

    # nation Says:
    September 3rd, 2007 at 4:02 am

    no more Entourage until June 08th?

    we need a board


  726. cMac Says:

    # nation Says:
    September 3rd, 2007 at 4:02 am

    no more Entourage until June 08th?

    we need a board

    that’s whack!

  727. Soul Clapper Says:

    Nah Right Lite

    Hip-hop stars go into battle over the future of a stuttering genre:

    Eskay, author of Nah Right, a popular hip-hop blog, said: “I think there are a variety of factors and it would be crazy to say the internet hasn’t had an effect. But mostly there has been a decline in the quality of albums being put out.

    “Nowadays we see a lot of what have come to be known as ‘ringtone rappers’ who are essentially one-hit wonders. And everybody is an A&R nowadays. Everybody wants to know what the [sales figures] are for the week and everybody has an artist they’re pushing and a MySpace page. It’s awful.”

    ^^^ “It’s awful” = the new “Shit’s disgusting, B”

  728. Plug Says:

    Nothin like goin over moms crib for a home cooked meal early in the morning.

    mornin scrubs (c) snoop

  729. spotrusherz Says:

    hey if you’re a modern rap scholar go listen to weezy spittin over the excuse me miss beat here http://www.xxlmag.com/online/?p=12243# and tell me who’s that on the second verse. easily the most ignorant, antisocial verse i’ve heard in a while.

  730. Joe 88 Says:

    *Pulls up in nah right parking lot bumping lil wayne “something you forgot”*

    *Turns volume up to 76243907…..63456356*

    *Passes plug, missing him by inches (nh)*

    *Takes eskay’s handicap parking spot*

    *Gets out of car*

    *Walks towards nah right campus*

    *Throws empty cup behind back, making it into parking lot trash can*

    *Tilts fitted*

    *Greenie & LL (not the rappa) magically appears*

    *Cuffs both of them under arms*

    *Walks into nah right building*

  731. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 8:29 am
    *Pulls up in nah right parking lot bumping lil wayne “something you forgot”*

    *Turns volume up to 76243907…..63456356*

    *Billz hears wack music coming from Joe’s whip*

    *throws cantalope sized rock at his back window*

    *Passes plug, missing him by inches (nh)*

    *Takes eskay’s handicap parking spot*

    *Gets out of car*

    *Walks towards nah right campus*

    *Throws empty cup behind back, making it into parking lot trash can*

    *Tilts fitted*

    *Greenie & LL (not the rappa) magically appears*

    *Cuffs both of them under arms*

    *Walks into nah right building*

  732. Joe 88 Says:

    lol @ Billz, what it dew homie?


    ^Peep this shit out billz, I don’t know why, but this ninja is too funny

  733. benhameen Says:

    good morning kids. or good afternoon as it in Addis. Yo any of you blogger types can you tell me how to make words links? So when I type idiot on a computer and you scroll over it you can click to link to a pic of me?

    *hopes self deprecating humor keeps the smart ass learn to use html comments to a minimum*

    can someone else send me eardrum? or i guess ill just torrent it.

    what up billz joe 88 greenie LL?

  734. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 9:03 am
    lol @ Billz, what it dew homie?


    ^Peep this shit out billz, I don’t know why, but this ninja is too funny

    ^Yerrrrrrrrrroooo @ Joe88… aint shit fam, chillin’. What it is?

    Yo, I must got ESP(N) because I was already thinkin’ that was the clip you was gonna post. I peeped this a few months ago and was crackin’ up. I don’t know why that shit is funny either but it is. Lol


    Continuation from yesterday

  735. D. Billz Says:

    Ben Ha… What it is?

  736. Joe 88 Says:

    lol @ this martin clip


    Gina: So guys what are ya’ll gonna do today?

    Martin: I’m thinking bout going to the mall, get those new air jordan’s, they all that

    Tommy: Yeah, there alright

    Martin: Alright? They better than those “scare Jordan’s” you got on tommy

    *Books flight to the floor*

  737. SmackJackTheCrackaMan Says:

    What up nah right??

    Has any heard of “Mekolicious” think he was down with Pete Rock, has he dropped any albums??

  738. It'smeSNITCHES Says:

    Wat up y’all……..

  739. D. Billz Says:

    Youtube comment on that Dragonfly clip:

    phreshman (3 months ago) Show Hide Marked as spam 0 (Reply)
    (:56) Get off me Thickums LOLOLOL and was it necessary to break a chair over a bowl of popcorn hahahahahahahahaha

    ^ *dies*

  740. It'smeSNITCHES Says:

    Graduation beat Curtis in downloads…..this weekend

  741. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 10:03 am
    lol @ this martin clip


    Gina: So guys what are ya’ll gonna do today?

    Martin: I’m thinking bout going to the mall, get those new air jordan’s, they all that

    Tommy: Yeah, there alright

    Martin: Alright? They better than those “scare Jordan’s” you got on tommy

    *Books flight to the floor*

    ^ *reads that out loud*

    *diving head-butt to the floor*

    Yo… I was just sittin’ here thinkin’ about how Martin Lawrence is definitely top 3 now, with only Eddie and Richard being above him. Nobody else can make you laugh as much as Martin doing stand-up AND on tv shows. But he’s still #3 because Eddie’s movies are funnier than Martin’s.

  742. Sh*t Son Says:

    Billy Connelly > Ur Fav stand up

  743. D. Billz Says:

    @ Ben Ha


    ^That’s how you do hyperlinks, which is what I think you’re referring to. I would show you myself on NR, but eskay might got it disabled.

  744. Plug Says:


  745. D. Billz Says:

    Ben Ha… check your Yahoo mail.

  746. D. Billz Says:

    Plug… Sh*tSon… snitches…

    What it is?

  747. Joe 88 Says:

    #3 Is a respectable place on the all time black comedians list, no one is gonna be ranked over Richard pryor period, & Eddie’s track record is legendary, so that leaves martin ahead of everyone else by a landslide. Martin was one of the only people that could make you laugh by just moving (pause) & some of the charactors he played on the show are some of the funniest ever.

    Otis the security guard
    Dragon fly jones
    The white guy that works @ gina’s job
    Momma payne
    King beef

    & so on. His movies are timeless also, tears still roll down my face everytime I watch Bad Boys 2, the part when that lil nigga came to take his daughter out is hilarious in 32467827587209 different ways, & his stand up’s are classics also. It took me a 2nd look, but “run tell dat” is 4.9 out of a five. So I have no problem with martin being #3, but anything under that is plain disrespectful

  748. Joe 88 Says:


    ^The reggie scene from bad boys 2. lol @ martin answering the door saying “WHO THE FUCK IS YOU!!!!!!!!”

    *Eats pop rocks & drink soda*


  749. Sh*t Son Says:

    What up Billz,

    Martin Lawrence Film > ML Stand Up

    ive not seen that much, but i remeber watchin def comedy jam, it seemed fake as sh*t. Martin would tell a weak joke and pull really annoyin faces!!
    Ive not seen that much more of him, but tht def put me off watchin it more

    Chris Rock > Martin Lawrence

  750. Soul Clapper Says:

    Global KanYe Vs 50 Update:

    UK Chart Positions:

    50 languishes at No. 11, dropping from a high of No.10. Last week’s UK No.1 single, KanYe West’s Stronger, is at No.2 this week.

    50 lost. Globally.

  751. Plug Says:

    yo, how yo maje the letters bigg. Jr, dun messedf the screen uP

  752. Cocca88CRAZY88SINCE88 Says:

    Applaud Grover, he just rode in on a Camel to Sesame Street.
    (hov Lost)

  753. Sh*t Son Says:

    Global KanYe Vs 50 Update:

    UK Chart Positions:

    50 languishes at No. 11, dropping from a high of No.10. Last week’s UK No.1 single, KanYe West’s Stronger, is at No.2 this week.

    50 lost. Globally.


    Ive seen 50 song wi JT on the box a couple times. He has no nuzz her at all. Stronger has been on constantly.

    I think both are wack tho

  754. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 10:22 am
    #3 Is a respectable place on the all time black comedians list, no one is gonna be ranked over Richard pryor period, & Eddie’s track record is legendary, so that leaves martin ahead of everyone else by a landslide. Martin was one of the only people that could make you laugh by just moving (pause) & some of the charactors he played on the show are some of the funniest ever.

    Otis the security guard
    Dragon fly jones
    The white guy that works @ gina’s job
    Momma payne
    King beef

    & so on. His movies are timeless also, tears still roll down my face everytime I watch Bad Boys 2, the part when that lil nigga came to take his daughter out is hilarious in 32467827587209 different ways, & his stand up’s are classics also. It took me a 2nd look, but “run tell dat” is 4.9 out of a five. So I have no problem with martin being #3, but anything under that is plain disrespectful

    ^Co-sign. I think what you’re referring to in the first paragraph is physical comedy. Imo, physical comedy is just a natural gift because not everyone can get the same reaction from the audience. And people can tell when it’s voiced. The jokes, per se, can be copied which is wack. I was at somebody’s Myspace (some promotion/dvd company) and they an interview with the comedian Talent Harris on there (the “it’s just cooomedy” dude), and he was talkin’ about how ninjas be stealin’ jokes. If you notice, so many mofos out there are tryin’ to recreate Martin’s style, stage presence, and swag (I swear, hip hop has made me hate that word) but can’t. Even Chris Rock game him props (and was kinda firing shots at Bernie, Steve, Cedric, DL) when Martin came on Chris’ HBO show and he called him the REAL king of comedy. Martin coulda shut down that Kings of Comedy by himself IN EVERY CITY. And I remember vividly when RunTelDat came out… Summer of ’02… me and 2 other classmates from my Comp. Tech. class at Towson U. Yooooo… I was in there with tears in my eyes. And the crazy part, it still can’t mess with You So Crazy. I know that damn movie by heart. So many quotables. So yeah, #3 is definitely the right spot. Now watch MTV come out with a greatest comics list in a few months (because I swear mainstream media be jackin’ NR comments) and totally disrespect his position.

    On another note, the only good physical comedian out right now is Tony T. Roberts. That 7 minute Def Comedy jumpoff had me dyyyyyin.

  755. Joe 88 Says:

    Chris Rock > Martin Lawrence

    *Lowers head (nh)*

    There style is very different, I can say that chris rock stand ups are timeless, but martin’s show trumps his stand up’s because there’s so many good episodes of martin, actually there isnt a bad episode of martin period, it’s rare that a stand up comic can make that crossover to TV & be sucessful. IMO Martin is the best show ever, I remember when martin got a lifetime award & chris rock gave the award he even said the martin show is the best show ever. I like Chris rock too (pause) but I prefer Martin over Chris & chris needs to stop playing & do another stand up special before I get mad.

  756. Sh*t Son Says:


    I was talkin about stand up only. Never seen martin i dont think.

  757. Plug Says:

    #3 Is a respectable place on the all time black comedians list
    I gotta say 4th


  758. D. Billz Says:

    Sh*t Son Says:

    September 3rd, 2007 at 10:26 am
    What up Billz,

    Martin Lawrence Film > ML Stand Up

    ive not seen that much, but i remeber watchin def comedy jam, it seemed fake as sh*t. Martin would tell a weak joke and pull really annoyin faces!!
    Ive not seen that much more of him, but tht def put me off watchin it more

    Chris Rock > Martin Lawrence

    ^Mannnn… I couldn’t disagree with you more. I guess to each his own, but CR over Martin? Naaaaaaaaahhhhh. Not even close, and I’m a CR fan. Saw all of his stand-ups and liked ’em.

  759. Plug Says:

    redd foxx reminds me of my old dude. Big glasses, all white hair wit no baldness, smokin squares and crazier than a muhfugga

  760. Joe 88 Says:


    ^This ninja = top 5 comedians

  761. Plug Says:

    I was talkin about stand up only. Never seen martin i dont think.
    …uh… did I read that right?

  762. Plug Says:

    I think you gotta put this guy up there too…


  763. Sh*t Son Says:

    ^Mannnn… I couldn’t disagree with you more. I guess to each his own, but CR over Martin? Naaaaaaaaahhhhh. Not even close, and I’m a CR fan. Saw all of his stand-ups and liked ‘em.


    I think the def comedy jams seemed fake, down to the crowd goin total nuts over so so jokes. Its diff i suppose coz im in the UK, so i suppose i miss some of the jokes and so on. U ever heard of Lee Evans?? i dont know if he’s that big in America, he was in Something about Mary??
    His XL Tour was brilliant, the things he was pickin out about everyday life i suppose that stuff is diff country to country

  764. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 10:35 am
    Chris Rock > Martin Lawrence

    *Lowers head (nh)*

    There style is very different, I can say that chris rock stand ups are timeless, but martin’s show trumps his stand up’s because there’s so many good episodes of martin, actually there isnt a bad episode of martin period, it’s rare that a stand up comic can make that crossover to TV & be sucessful. IMO Martin is the best show ever, I remember when martin got a lifetime award & chris rock gave the award he even said the martin show is the best show ever. I like Chris rock too (pause) but I prefer Martin over Chris & chris needs to stop playing & do another stand up special before I get mad.

    ^Word. But chris only do them shits like every 3 years. But I heard recently that he’s supposed to be filming for another stand-up soon… which should be accurate because Never Scared came about 3 years ago. But yeah, CR got way more stand-up joints that MOST of us seen. However, Martin got a HBO One-Night Stand (when that used to come on… Damon Wayans One Night Stand is hilarious) and a few other smaller venue joints (one which I have on CD) that are hilarious. But on larger scale, I can agree that CR trumps him as far as stand-up shows because he has done more. So maybe I was a lil’ overzealous in my comparison. Not to mention that Martin’s stand-up career is pretty much done. CR got about 2 or 3 more left in him.

  765. Sh*t Son Says:

    Plug Says:

    September 3rd, 2007 at 10:45 am
    I was talkin about stand up only. Never seen martin i dont think.
    …uh… did I read that right?


    Martin Lawrence was never that big here till Bod Boys came out

  766. D. Billz Says:

    Plug Says:

    September 3rd, 2007 at 10:41 am
    #3 Is a respectable place on the all time black comedians list
    I gotta say 4th


    ^Damn, I aint know ninjas was shinin’ like that on the jewelry tip back then. Redd’s medallion was brolic.

  767. Sh*t Son Says:

    LOL @ Bod Boys, u know what i meant

  768. D. Billz Says:

    Sh*t Son Says:

    September 3rd, 2007 at 10:51 am
    Plug Says:

    September 3rd, 2007 at 10:45 am
    I was talkin about stand up only. Never seen martin i dont think.
    …uh… did I read that right?


    Martin Lawrence was never that big here till Bod Boys came out

    ^Well, being that you’re in the U.K. I can kinda understand why his humor may not crossover to the audience over there. But trust me, nothin’ was scripted about the laughter in those Def Jam shows. Back then, those joints were filmed in the heart of New York City which anybody doin’ any type of entertainment will tell you is the toughest crowd in the world. So yeah, during that time period he was the funniest mofo to walk the streets.

  769. D. Billz Says:

    Sh*t Son Says:

    September 3rd, 2007 at 10:52 am
    LOL @ Bod Boys, u know what i meant

    ^Because that’s how it sound to you with that weird ass UK accent. Lol


  770. It'smeSNITCHES Says:

    Wat up D. Billz?

  771. Joe 88 Says:

    All this talk about martin makes me wanna go find my Martin lawrence stand up cassette tape. That shit was too funny, the only person i’ve heard talk about it on here was X-Facta

  772. miltee Says:

    WTF ESKAY SLACKS ON weekends!!!!

  773. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 11:00 am
    All this talk about martin makes me wanna go find my Martin lawrence stand up cassette tape. That shit was too funny, the only person i’ve heard talk about it on here was X-Facta

    ^LF: Speakin’ of Xfacta (since he’s a fan), have you heard that Bossman “Can’t Tell Me Nothin'” freesytle? He murks it.

  774. Sh*t Son Says:

    D. Billz Says:

    September 3rd, 2007 at 10:55 am
    Sh*t Son Says:

    September 3rd, 2007 at 10:52 am
    LOL @ Bod Boys, u know what i meant

    ^Because that’s how it sound to you with that weird ass UK accent. Lol



    Anywayz, good talkin about somethin that isnt Kanye or Fif, thats me for the day.

  775. Joe 88 Says:

    >have you heard that Bossman “Can’t Tell Me Nothin’” freesytle? He murks it.

    ^Naw, but i’ve heard his free over the “I get Money” beat, he killed it, his mix cd dropped like 2 weeks ago, they played a couple cuts on the radio a while back, they was heat, but I’ll look for that free you talking bout billz asap


    ^More Martin stand up, Classic shit

  776. D. Billz Says:

    miltee Says:

    September 3rd, 2007 at 11:03 am
    WTF ESKAY SLACKS ON weekends!!!!

    ^you aint know?

  777. D. Billz Says:



  778. Rey Says:


  779. benhameen Says:

    Whats up kids? Thanks billz. Just finished reading through Im not the biggest martin fan I would have to say he is at least fourth behind Rich Eddie and Redd. His show never did it for me too much coonery to me. I dunno his impersonations or characters whatever you wanna call them just werent that funny to me but I know im in the minority on this one. Now Richard Pryor that man is God on the comedy circuit. NOONE and I mean noone can touch him.
    Um heath ledger is playing the Joker in the new batman. interesting choice i know but from what Ive seen he looks like he has the role down pat. It may or may not feature Two face too. Rumor says that Joker will create Two Face by throwing the vat of acid at him.
    And Batman has always been a master of martial arts. and the worlds greatest detective

    *goes back into geek mode*

    Batman Begins> any other superhero movie except possibly X2 and Superman 2.
    KNEEL BEFORE ZOD! just cant be topped.

  780. benhameen Says:

    I agree though that scene in Bad Boyz 2 is a classic. And his stand up is funny as fuck. I prefer Chris Rock though because he has the political side like a Rich Pryor. Too me there is Rich and then there are a bunch of sorta funny guys. Really watch rich and you will see everything that every other comedian has done since.

    Its hilarious being across the pond as they say cuz while your day is just getting started Im ready to go to sleep. The rain season sucks in Ethiopia man. It rains every day just makes me wanna lay up in this super plush hotel and order room service. and maybe a hooker.

    *checks HIV rates in africa*

    *decides maybe sleeping alone aint a bad idea*

  781. benhameen Says:

    *paragraph crickets*

    anybody got a link to CUUUURRRTIS? or talib? Ima stop fronting like i buy shit.

    Its awful.

  782. benhameen Says:

    *goes for four in a row*

    slow monday morning round here.

  783. benhameen Says:

    well new post at my joint…

  784. OnPoint Says:

    whaddup tho?

  785. D. Billz Says:

    benhameen Says:

    September 3rd, 2007 at 11:36 am
    Whats up kids? Thanks billz. Just finished reading through Im not the biggest martin fan I would have to say he is at least fourth behind Rich Eddie and Redd. His show never did it for me too much coonery to me. I dunno his impersonations or characters whatever you wanna call them just werent that funny to me but I know im in the minority on this one. Now Richard Pryor that man is God on the comedy circuit. NOONE and I mean noone can touch him.
    Um heath ledger is playing the Joker in the new batman. interesting choice i know but from what Ive seen he looks like he has the role down pat. It may or may not feature Two face too. Rumor says that Joker will create Two Face by throwing the vat of acid at him.
    And Batman has always been a master of martial arts. and the worlds greatest detective

    *goes back into geek mode*

    Batman Begins> any other superhero movie except possibly X2 and Superman 2.
    KNEEL BEFORE ZOD! just cant be topped.

    ^Like Paul Mooney said, though it was coonery it was bar none the funniest show to watch. And I forgot about Redd so that still puts Martin in a respectable 4th. The irony of it all is that Martin was very pro-Black in most of his acts in stand-up AND on his show. But most of it got overlooked due to the brazen physical comedy (i.e. the RBG clothes, Spike Lee pics in the background, etc). Or you could just chalk it up to the fact that his show debuted in the midst of the pro-Black period. But I digress.

    As for Batman, I’m sorta into martial arts so to have that display of ninjitsu intertwined with his character was genius. Ninjas (literally… lol, inside joke) move in stealth and are trained assassins which coincides with the whole bat theme. Kinda ill.

    *deactivates geek mode*

  786. Joe 88 Says:

    New post

  787. benhameen Says:


    ^Like Paul Mooney said, though it was coonery it was bar none the funniest show to watch. And I forgot about Redd so that still puts Martin in a respectable 4th. The irony of it all is that Martin was very pro-Black in most of his acts in stand-up AND on his show. But most of it got overlooked due to the brazen physical comedy (i.e. the RBG clothes, Spike Lee pics in the background, etc). Or you could just chalk it up to the fact that his show debuted in the midst of the pro-Black period. But I digress.

    As for Batman, I’m sorta into martial arts so to have that display of ninjitsu intertwined with his character was genius. Ninjas (literally… lol, inside joke) move in stealth and are trained assassins which coincides with the whole bat theme. Kinda ill.

    *deactivates geek mode*

    true indeed god true indeed…

    whenever I do watch martin I do like how he has so much pro black stuff in the background. and since you mentioned mooney martin may have to move to five. Not sure where you put Mooney since he has written for every great comedian even Rich.
    And as true comic book geek the martial arts has always been a part of batmans forte.
    I think Bale did the best job as both Batman and Bruce Wayne. Keaton was a great Wayne not so good as Batman

    1. Bale
    2. Keaton
    3. Kilmer
    4. Clooney (who said it was his fault the franchise came to such a horrible end)

    *tries to deactivate geek mode*
    *realizes its permanent*
    * charges power ring instead*

    in darkest night….

  788. D. Billz Says:

    Joe 88 Says:

    September 3rd, 2007 at 12:09 pm
    New post

    ^I should duff you for makin’ me scroll up. And then kill myself knowin’ damn well eskay don’t post on weekends and holidays (except for that damn Valentines post that I’d like to forget about).

  789. Joe 88 Says:

    >I should duff you for makin’ me scroll up. And then kill myself knowin’ damn well eskay don’t post on weekends and holidays (except for that damn Valentines post that I’d like to forget about).

    ^lol, I knew I would get someone with that. The “new post” thing (pause) never gets old

    New Post > First

  790. benhameen Says:

    damn yo being in africa i forgot its labor day….thats why its so dead in here

  791. D. Billz Says:

    true indeed god true indeed…

    whenever I do watch martin I do like how he has so much pro black stuff in the background. and since you mentioned mooney martin may have to move to five. Not sure where you put Mooney since he has written for every great comedian even Rich.
    And as true comic book geek the martial arts has always been a part of batmans forte.
    I think Bale did the best job as both Batman and Bruce Wayne. Keaton was a great Wayne not so good as Batman

    1. Bale
    2. Keaton
    3. Kilmer
    4. Clooney (who said it was his fault the franchise came to such a horrible end)

    *tries to deactivate geek mode*
    *realizes its permanent*
    * charges power ring instead*

    in darkest night….

    ^Lol. I totally forgot that Mooney wrote madd shit for Pryor AND Eddie. But, he don’t really have too many stand-ups under his belt. It’s kinda hard to put a writer above the actual comic. It’s like puttin’ Sauce Money above Jay-Z. LF: Is Mooney gay?

    And I don’t even remember Bale. Bale? Kilmer was pretty decent. Keaton, he jumped off the first one in the 90’s so he always gets props. But Kilmer played a better Batman than Keaton. Clooney? Eh. I guess since he was at the peak of his popularity and he was of age, that it made sense. But, nah.

  792. D. Billz Says:

    Just saw what I typed and realized Bale was the latest one.

    *lowers head*

    *slits wrists*

    *does push ups in salt water*

  793. Jeter22 Says:

    You should have popped up 24hrs ago!! That curtis was up but shiiit I like esgay little spot here so I aint tryin ta repost it and get the nigga shut down……..

    “The Deeeez tried ta plant uh pistol on me”

  794. Jeter22 Says:

    Actually its still up there if you scroll through real slow you’ll find it…

  795. benhameen Says:

    You know Im not sure about Mooney he does have some feminine tendencies thats for sure. And Bale christian bale from batman begins… Kilmer may b a better batman but Keaton had the whole Im a pyscho who runs around in a bat suit down pat.
    Side note The Killing Joke by Alan Moore should b required reading for any Batman fan. I read it way back in the day wasnt a batman fan at all back then and that shit had me hooked.


  796. benhameen Says:

    Just saw what I typed and realized Bale was the latest one.

    *lowers head*

    *slits wrists*

    *does push ups in salt water*

    yeah i was like ummm? but pushups in salt water jeez….oh and billz let me tell you there are a million and one Bettys over here. But if you dont get on your game im still all over her when i get back.

  797. D. Billz Says:

    benhameen Says:

    September 3rd, 2007 at 12:32 pm
    Just saw what I typed and realized Bale was the latest one.

    *lowers head*

    *slits wrists*

    *does push ups in salt water*

    yeah i was like ummm? but pushups in salt water jeez….oh and billz let me tell you there are a million and one Bettys over here. But if you dont get on your game im still all over her when i get back.

    ^Do what you gotta do, popcorn playa. Lol. How old is she anyway?

  798. HHF Says:

    somebody pass me some barbecue or something

  799. benhameen Says:

    ^Do what you gotta do, popcorn playa. Lol. How old is she anyway?

    not sure actually…her facebook page says she is 27? perfect for an old man like meself. even though i usually like em a lil younger…but damn thats a bad woman…

  800. G7 Says:


Leave a Reply